NCBI Blast Tutorial
Loading...
Loading...
6,929
Loading...
There is no Interactive Transcript.
4:04
How to: Construct a Plasmid Map.mp4by cljgay1,085 views- 4:36
BLAST (Bioinformatics)by symfe3,005 views
- 1:12
NCBI BLAST Tutorial - Part 1by jjv51jjv53,847 views
- 4:09
Bioinformatics 101 - Introby plantbreedgenomics3,611 views
- 0:49
NCBI BLAST Tutorial - Part 2by jjv51jjv51,756 views
- 14:24
How to design primers for PCRby thekingclay5,349 views
- 8:11
NCBI Blast search tutorialby ohiobiologist4,685 views
- 2:48
Obtain Genomic Sequence for a geneby NCBINLM4,046 views
- 2:39
Using NCBI for Primer Designby srlab1,527 views
- 14:52
Bioinformatics 101 - Running BLASTby plantbreedgenomics1,267 views
- 0:56
Be kind to your web-footed friends - Childrens songby samianne1220,360 views
- 5:08
BLAST(basic local alignment search tool)by hopejuli4,710 views
- 3:06
NCBI BLAST Tutorial - Part 3by jjv51jjv51,198 views
- 8:59
SwissPDB Viewer Tutorialby jjv51jjv51,871 views
- 9:46
swiss PDB Viewerby biominglevideo3,692 views
- 6:03
Bioinformatics Tutorials (Lesson 1):Using SwissProt database to search for a specific proteinby Htheshadow5,955 views
- 5:47
BIT 2.3: Nucleotide BLASTby MITLibraries2,019 views
- 5:15
Bioinformatics Exercise 1 Finding DNA Onlineby zinshandra1,030 views
- 4:20
Multiple sequence alignment with clustalw and boxshadeby sanjaysingh765940 views
- 0:45
BLAST Searchby bimaticsblog1,734 views
Here's the rat sequence from this video, in case anyone wants to try it themselves:
>rat example protein
MGLWSPVPGNSVPRAPVMAGLGLGHSOGAPOBPHDGKTDRSSGPGRRRTERTRLPGLLGG
APLTAGSPHRWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMSHRMEGVGQLPA
SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCGGPSRLCKHVL
SARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKAGLGTWVRKPPE
QQQFLLTL
TheGiantSlor 3 days ago
grt ... for blast learner ,,,
tupac2133 7 months ago
I want to upload a set of sequences, what's the maximum sequences inside the file or the maximum size of the file to be uploaded?
rivosuoth 8 months ago
@rflejeune Thanks. I downloaded the readme.
OccamsRzzr 1 year ago
@OccamsRzzr E-value is the "expectation value". Here's what the NCBI website has to say about it: "(It is) the number of different alignents with scores equivalent to or better than S that are expected to occur in a database search by chance." S is referring to the raw score. You can find out more about it at the NCBI website. Essentially, an e-value works like a p-value, the smaller the better.
rflejeune 1 year ago
what is the evalue ? THis is soooo cool .
OccamsRzzr 1 year ago