It's nice to know exactly how the world was created. Mountain, trees, midget... It all makes sense now! May everyone be touched by his noodly appendage! Praise the Flying Spaghetti Monster! RAmen!
The Flying Spaghetti Monster was an invention of Bobby Henderson in response to the State Board of Education of Kansas's attempt to promote intelligent design. It makes for a very humorous picture, although it provides virtually no analogy to God's character. Spaghetti and meatballs are the physical creation of intelligent beings and could never exist outside of a human domain.
The flying spaghetti monster is the way and the light. Do not be fooled by the bogus religion known as Christianity. AIlow yourself to be touched by his noodly appendage... Open your eyes my friends... His Noodleness loves you whether you accept him or not.
@Stebsey1 The Flying Spaghetti Monster was an invention of Bobby Henderson in response to the State Board of Education of Kansas's attempt to promote intelligent design. It makes for a very humorous picture, although it provides virtually no analogy to God's character. Spaghetti and meatballs are the physical creation of intelligent beings and could never exist outside of a human domain.
Those sound effects were not created by a human being. They are the actual sounds made when the Flying Spaghetti Monster created the world. It is anti-pasta bigots like you that are the cause of all terrorism and disease. You are a faithless baby killer!
@pupsenok Wow dude! Seriously? You put something that hurtful for a comment that wasn't even an insult!???? WOW! That was bad! You seriously need help!
Are you that much of a pastafarian nutcase to think that I am making actual claims about the sounds made by the Flying Spaghetti Monster and anti-pasta bigots?
It was sarcasm! There is no such thing as a Frlying Spaghetti Monster! I do not know the actual sound a Flying Spaghetti Monster would make when creating the universe.
Methinks that your tin foil hat is on too tightly.
FSM be praised. My only sin is that I have difficulty telling the difference between anti-Pastafarians (usually believers in some vindictive, intolerant megalomaniacal desert god) and tin-foil hat wearing nutcases. I despise the former and pity the latter.
Ok this is the most assholish thing i've ever seen. I may be an evolutionist but come the fuck on what happened to respect for another person and leaving alone their point of view? Just what the fuck is wrong with you people today?
@Edwarddoom And there's that assholishness again, like i said back when i was growing up christians and atheists got along, to some extent but they respected eachothers personal differences and didn't make bullshit like this. So fuck you.
@narutardted .... You do realise of course that the FSM is infact a Joke Put together to prove a Point to the Kansas School Board about including ID in the Classroom It is not infact an Insult .... in any way shape or form ... Narutardted I suggest you look into the origins of the FSM in real life as atm you are looking at the comedy without seeing the point behind it
blasphemy from a infidel How dare you offend my holy and one true religion.Ceiling cat Gen 1:3 At start, no has lyte. An Ceiling Cat sayz, i can haz lite? An lite wuz.4 An Ceiling Cat sawed teh lite, to seez stuffs, An splitted teh lite from dark but taht wuz ok cuz kittehs can see in teh dark An not tripz over nethin.
The FSM came down and kicked my ass because I had serious doubt about his existance. Then we had some ale and he kicked my ass after too much alcohol. But he was here.
@Keiranforreal You're right of course. At the same time though I had to make a link to concepts we were all familiar with in order to properly describe our encounter.
I'm Unitarian Universalist, unlike every other religons, we accept all beliefs that one may have, we don't discriminate against what other people believe, we're just open, so we accept people who believe in FSM, big or small
The entire point of Intelligent Desing is that the cosmos was made by an IMMATERIAL, SUPERNATURAL, ALL-KNOWING and ALL-POWERFULL entity, in other words, something DEVINE.
The Flying Spaghetti Monster does not qualify since it has none of those characteristics.
Get a clue Atheists. Try this rather than your FSM childishness :
Actually, Intelligent Design simply is attempting to advocate the notion that a designer of some sort was responsible for specific aspects of our biology. It says NOTHING about the origin of the universe.
Either way, it is rubbish no matter how you cut it. Simple concepts for simple minds.
Pasta does taste good. The idea that FSM covered up his YEC tracks, and falsified the fossil records, makes more sense than other religious explanations. And pirate clothes are cool.
Ramen. whilst watching this video i feel that, not only has the FSM touched you with his noodly appendage, you have touched me also with YOUR noodly appendage. FSM bless you, brother.
I was a non-believer, until I saw this video. Now I'm a convert and the FSM is part of my life. I will pray for those who still don't believe because the end is near.
Flying Spaghetti Monster bless you. Al dente of course!
Very powerful and deeply moving, especially at Christmastime! It's nice to see true spirituality using animation and the internet to spread the word of His Noodly Appendage. If only they will teach Pastafarian Creation in the churches alongside that other stuff, the way the Xtians want their religion taught alongside the science of evolution, more people would be enlightened. But the FSM works in mysterious ways, and I'm eating pasta for dinner!
You lying with this video. TAKE IT OFF YOUTUBE HEATHEN! GOD made the world by makings pop up out of nowhere with no scientific explanation [although we now have scientific explanations for them]
plus you left out the part where god made the fossils and fought santa claus and constricted him to the north pole where he is only free for 1 day of the year and he uses it to bribe us to believe in him with gifts.
To children esepecially, as form of childhood indoctrination....
Also, that's English. Not ancient Greek, or Latin, or whatever. English, with no vowels, punctuation, or spaces. By your standards, as you are an excellent English speaker, you should be able to translate that exactly as I intended it.
You seem really smart, but I don't know how I could make this any more clear. You can translate things correctly and still have them say different things, like the very first examples I gave [GDSNWHR, No pets are allowed].
well i understand your points very well, actually i am very interested in your points, i have to know ancient greek to make a conclusion, i do understand your point! thats not the problem, but you dont know ancient greek well enough to pinpoint a contradiction in the translations. i would ask a expert, like my pastor, he took ancient greek and liberty universtiy, i should ask him.
katherine... i know this may sound mean, but you dont know greek and neither do i, so lets ask the expert! you are arguing about something that you have minimal knowledge about! ask the experts not me, lol
It should be no problem, as you're an English speaker and should understand that as well as people that know ancient Greek understood the ancient text.
OMG...lol wow, OK let me say again, u dont understand ancient greek to translate it, i dont understand ancient greek to translate it! a lot of english speakers dont understand ancient greek to translate it. BUT THERE IS A SLECT FEW THAT KNOW THE LANGUAGE, AND CAN UNDERSTAND IT AND READ IT, even without spaces! thankyou! lol
IT'S NOT ABOUT THE ANCIENT GREEK. IT'S ABOUT A TEXT MISSING HALF ITS LETTERS.
Okay, there are masters of ancient Greek. Check. They can translate text. Check. There is, however, no way to know if what they translate is exactly what was intended! You're a master of English. You could translate the text below. What I'm saying is that you can't be sure that what you translate is exactly what I wrote.
I take back what I said about you seeming smart;; you're kind of stupid.
oh geez now you are insulting me, lets take a step back. ok now we understand that you know very little about translating any language with no spaces, check. ok, there are a vast amount of people that know ancient greek and have confirmed its accuracy. The scribes in the biblical days were so anal about copying the bible, they broke the utensil every time they wrote God's name and took a bath. Plus, if there were any mistakes, they would simply throw OUT THE WHOLE SCROLL! =)
I'm not talking about mistakes;; I've never been talking about mistakes. I'm talking about discrepancies and commentary. Translating something, no matter how "accurately", still leaves room for discrepancies, which is known as commentary from the individual translators. Biblical text was first of all told through many generations and wasn't the same exact story as it was when it was first told. It was then written down without vowels, the individual texts were reviewed at Nicea and some texts..
were left out. It was then translated and retranslated and then translated into what we have today. It is not exactly what was written down, nor what was told originally and definitely not what actually happened. It is therefore not a reliable historical reference, which is all I've been saying this entire time.
lol ok i get you until the reliable historical reference part, i do understand that languages have differences between grammer. i understand that what we have today is not exactly worded as back then. thats why we have scholars that justify the credibility. if you know ancient greek and say that there is a translation problem then i would be fine, but you dont know ancient greek. its like me criticizing a book that i haven't read, i would have to read the book first to criticize it. cont.
well actually there were manuscripts written as soon as 10 years after the resurrection. Plus, there is a incredible reference of history, in fact, if you truly study history, you will find out that Luke (the writer of Luke and Acts) was write and the historians were wrong. ex. in Acts 18:12, it says Gallio was proconsul of Achaia, WHAT proconsul... the later historians did not refer him as a PROCONSUL, so historians thought that he had made a mistake. BUT CONT.....
He was only proconsul for a year, and in the ancient greek/roman times, there wasn't enough documentation to expect historians from years later to be aware of things that happened fleetingly in places that weren't really that important in the scheme of things.
haha EXACTLY!!! ALL THE HISTORIANS MISSED IT LATER ON CENTURIES LATER, BUT LUKE DID NOT MISS IT..... SOOOO THIS MEANS TWO THINGS..
one he is very anal about detail and not leaving anything out
two he to remember something in such detail, Luke had to write LUKE and ACTS in the early 1st century!
Yes the old testament was written in Hebrew, or i believe most of it. lol idk how we started talking about Ancient Greek, lol haha But the whole new testament was written fully in Ancient Greek.
Well your first point doesn't make much sense... Yes, he included something he knew that other wouldn't know years later... That doesn't mean he didn't leave anything out. Sooo yeah.
And were we ever arguing about your second point? ...No.
I'm pretty sure I was all "The bible was written without any vowels or punctuations" and you were all "I don't know Ancient Greek, do you???" And we then applied everything we said to ancient Greek.
oh cooking of the world wonderful
RAmen
ImTheMasterOfMasters 2 days ago
rahman ve rahim olan FSM'nin adıyla oku! ♥
Mtatli 8 months ago
@Mtatli Ulan sen musluman degilmisin! tuh sana
TaskinKosedag 7 months ago
Comment removed
Mtatli 7 months ago
@TaskinKosedag Ramen ♥
Mtatli 7 months ago
@Mtatli Sen simdi musluman degilmisin?
TaskinKosedag 7 months ago
@TaskinKosedag elhamdirillah
Mtatli 6 months ago
This has been flagged as spam show
Hale spaghetti full of grace the sauce is in with you,
Blessed art thou amongst noodles,
and blessed is the fruit of thy womb, Stomach.
Holy Spaghetti, Mother of Pasta,
pray for us Fat boy,
now and at the hour of our death.
Ramen...........
pogsx69x 9 months ago
This has been flagged as spam show
Hale spaghetti full of grace the sauce is in with you,
Blessed art thou amongst noodles,
and blessed is the fruit of thy womb, Stomach.
Holy Spaghetti, Mother of Pasta,
pray for us Fat boy,
now and at the hour of our death.
Ramen.....
pogsx69x 9 months ago
You didn't show the part where He got completely hungover :(
MedaX 9 months ago
It's nice to know exactly how the world was created. Mountain, trees, midget... It all makes sense now! May everyone be touched by his noodly appendage! Praise the Flying Spaghetti Monster! RAmen!
darkpunkrocker101 9 months ago
ramen!
joshuamyler 10 months ago
Rämen!
KimboRamboFin 10 months ago
at least it actually has balls, meatballs that is
uwsheart 10 months ago
this makes more sense than a snake and an apple...RAmen
rusman74x 10 months ago
The Somali pirates are just misunderstood pastafarrians trying to stop global warming by becoming pirates and high jacking oil tankers.
bimmjim 10 months ago
RAmen
acrist777 10 months ago
May you be touched by His Noodly Appendage.RAmen
schroedingersdrache 11 months ago
Perfect sense.
ThomasMoar 1 year ago 2
May the Pasta be with you. RAmen.
Telacore 1 year ago
You keep the Turks. Turk March...
hbaf14 1 year ago
@AZcristian623
May you be touched by His noodly appendage my child. The FSM loves you.
I will pray for your lost Christian soul.
Ramen
Stebsey1 1 year ago
This has been flagged as spam show
The Flying Spaghetti Monster was an invention of Bobby Henderson in response to the State Board of Education of Kansas's attempt to promote intelligent design. It makes for a very humorous picture, although it provides virtually no analogy to God's character. Spaghetti and meatballs are the physical creation of intelligent beings and could never exist outside of a human domain.
AZcristian623 1 year ago
I applaud you ser.
sparkinator4 1 year ago
The flying spaghetti monster is the way and the light. Do not be fooled by the bogus religion known as Christianity. AIlow yourself to be touched by his noodly appendage... Open your eyes my friends... His Noodleness loves you whether you accept him or not.
Much love..
Ramen Ramen.
Stebsey1 1 year ago 2
This has been flagged as spam show
@Stebsey1 The Flying Spaghetti Monster was an invention of Bobby Henderson in response to the State Board of Education of Kansas's attempt to promote intelligent design. It makes for a very humorous picture, although it provides virtually no analogy to God's character. Spaghetti and meatballs are the physical creation of intelligent beings and could never exist outside of a human domain.
AZcristian623 1 year ago
Forgive, Oh Flying Spaghetti Monster, for I have sinned. Please grant me the divine grace of your noodly appendage.
Ramen.
ivasenko48 1 year ago
We have been touched by his noodly appendage. Ramen.
Zaroktheimmortal 1 year ago
For all you non-believers who say the FSM doesn't exist: If he doesn't exist, then how the hell did we get spaghetti???????
TheAmazingstarman 1 year ago
Actually, those sounds are from a song by Mozart.
thirteendays13 1 year ago
@thirteendays13 Mozart was inspired by his noodleyness.
dougules 1 year ago
those were the best sound effects ever created by any human being ever.
myco578 1 year ago
@myco578
Those sound effects were not created by a human being. They are the actual sounds made when the Flying Spaghetti Monster created the world. It is anti-pasta bigots like you that are the cause of all terrorism and disease. You are a faithless baby killer!
pupsenok 1 year ago
@pupsenok Wow dude! Seriously? You put something that hurtful for a comment that wasn't even an insult!???? WOW! That was bad! You seriously need help!
dude33ism 1 year ago
@dude33ism
Are you that much of a pastafarian nutcase to think that I am making actual claims about the sounds made by the Flying Spaghetti Monster and anti-pasta bigots?
It was sarcasm! There is no such thing as a Frlying Spaghetti Monster! I do not know the actual sound a Flying Spaghetti Monster would make when creating the universe.
Methinks that your tin foil hat is on too tightly.
pupsenok 1 year ago
@pupsenok ah you have shown me the light fellow pastafarian. fsm be praised.
myco578 1 year ago
@myco578
FSM be praised. My only sin is that I have difficulty telling the difference between anti-Pastafarians (usually believers in some vindictive, intolerant megalomaniacal desert god) and tin-foil hat wearing nutcases. I despise the former and pity the latter.
pupsenok 1 year ago
joyous!
ibolrecords 1 year ago
Ok this is the most assholish thing i've ever seen. I may be an evolutionist but come the fuck on what happened to respect for another person and leaving alone their point of view? Just what the fuck is wrong with you people today?
narutardted 1 year ago
@narutardted This is a Point of View We worship His holy Noodleness and we thank him for showing us how we can improve our world.
Edwarddoom 1 year ago
@Edwarddoom And there's that assholishness again, like i said back when i was growing up christians and atheists got along, to some extent but they respected eachothers personal differences and didn't make bullshit like this. So fuck you.
narutardted 1 year ago
@narutardted .... You do realise of course that the FSM is infact a Joke Put together to prove a Point to the Kansas School Board about including ID in the Classroom It is not infact an Insult .... in any way shape or form ... Narutardted I suggest you look into the origins of the FSM in real life as atm you are looking at the comedy without seeing the point behind it
Edwarddoom 1 year ago
@Edwarddoom I know in origins it's not an insult, but it's evolved to become one.
narutardted 1 year ago
@narutardted While I disagree with you in that ... i can see how it would come across that way
Edwarddoom 1 year ago
This is how it all went down, hail fsm. rAmen.
RickLectums 1 year ago
@RickLectums You do know he doesn't exist right?
dude33ism 1 year ago
@dude33ism
Judging by his comment to me, I think he actually believes in the Flying Spaghetti Monster.
I can barely tell the difference between Christian fundamentalism and Pastafarian radicalism.
pupsenok 1 year ago
blasphemy from a infidel How dare you offend my holy and one true religion.Ceiling cat Gen 1:3 At start, no has lyte. An Ceiling Cat sayz, i can haz lite? An lite wuz.4 An Ceiling Cat sawed teh lite, to seez stuffs, An splitted teh lite from dark but taht wuz ok cuz kittehs can see in teh dark An not tripz over nethin.
jakahn6661 1 year ago
how could that be sooo stupid xD
RuDeCookie7 1 year ago
cute little video. hail to fsm! ^_^
shakama2 1 year ago
Brings a tear to me eye.
barthburger 1 year ago
That is an epic vid! R'amen!
Ullelei 1 year ago
im searching for a T-shirt witf thet thing. :p
TheTNTee 1 year ago
oh my gaawd. such people are just disgusting :D
Boneox 1 year ago
BELIEVE IN HIM OR GO TO PASTA HELL!
ducktape53 1 year ago
and that kids, is how the world was created
mikeysa 1 year ago 8
I like the sound/fx
kakamatyi2 1 year ago
How retarded can people get?
TheSimsCreedGuy 1 year ago
@TheSimsCreedGuy Over 9000
jeffhellraiser2 1 year ago
damn thats sooooo trippy O.O
angeloffire76721 1 year ago
This video is heresy and shall NOT be accepted, take it down or fear the wraith of the Flying Spaghetti Monster.
ClickForOutkast 1 year ago
@ClickForOutkast Chill, dude. The FSM appreciates this kind of stuff. Anything to spread His word
jeffhellraiser2 1 year ago
The FSM came down and kicked my ass because I had serious doubt about his existance. Then we had some ale and he kicked my ass after too much alcohol. But he was here.
RAmen.
Imhornydadcomeinside 1 year ago 2
I will have to dock you a couple of points for not including any prophets (midgets). However, it was very good. RAmen
Stagey5000 1 year ago
I jerked off. Alllllll the way off.
fireofsev 1 year ago
Video evidence of how it must have all happened.
pumarunner88 1 year ago
RAmen
TheReasonWhyGuy 1 year ago 7
I saw the flying spaghetti monster with my two eyes!!!
eurythorpe 1 year ago 4
@eurythorpe so did I!
TheReasonWhyGuy 1 year ago
Blessed are he who have been touched by his noodleiness.
RAmen.
kimjuszczak 1 year ago
This video proves that pirates and midgets shall inherit the earth one day.
Ramen.
ytv122 1 year ago 3
AAAAAAAAAARRRGGGH Captain.
Ekendil 1 year ago
Hallsagna
Ozzy0sbourne 2 years ago
Jajaja, Ramen hermano!
hakka91 2 years ago
and on the 40th second, he rested
ranchhand345 2 years ago 4
the only Flying Spaghetti Monster
RAmen I also have been touched by his noodley apendage
bluecatdragon 2 years ago
I just got a tear in my eye.
gabbee16 2 years ago 4
@gabbee16 Same here T.T
TheReasonWhyGuy 1 year ago
My imaginary friend called the imaginary Flying Spaghetti Monster! Praise Jesus Christ for my friend's victory!
dorianmyrer21 2 years ago
I'm a pastafarian, and I'm proud!
IIedrem 2 years ago 3
Seeing is believing -Check out the video:"Flying Spaghetti Monster Boomerangs" Fly them in Church 18' to make converts!!!
flyingscience 2 years ago
Comment removed
flyingscience 2 years ago
está chulo el vídeo XD
roxy92diver 2 years ago
Raamén.
AsshhshsCompany 2 years ago
I have been touched by his noodley apendage.
Praise be to the Flying Spaghetti Monster.
RAmen.
ISDP1337 2 years ago 60
@ISDP1337 hehe
icecreamandcake1993 1 year ago
@ISDP1337 What makes the Flying Spaghetti Entity a monster or even a male monster for that matter?
Keiranforreal 1 year ago
@Keiranforreal You're right of course. At the same time though I had to make a link to concepts we were all familiar with in order to properly describe our encounter.
ISDP1337 1 year ago
@Keiranforreal I think it's his meatballs that make him a male monster.
ChiTown7721 10 months ago
RAMEN !! x33
KawaiiJapanCookie 2 years ago 4
ramen
themooddisorders 2 years ago 4
me ha entrado la jambre
greywasarrest 2 years ago
I'm hungry.
goatmilk222 2 years ago 38
ramen.
MIsfitsGraves 2 years ago 3
ramen
LOL666182 2 years ago 3
Only His Noodlyness could have possessed a decent quality CCD or CMOS camera back then.
rAmen
AgentCROCODILE 2 years ago
so what came first itali or the flying spaghetti monster
MrDeathkiller666 2 years ago 3
the egg
malakain900 2 years ago
Ñam Ramen x3! xD!
LizzyCardenasVIP 2 years ago
I'm Unitarian Universalist, unlike every other religons, we accept all beliefs that one may have, we don't discriminate against what other people believe, we're just open, so we accept people who believe in FSM, big or small
"Our belief is that you can believe."
YOITSJOE21 2 years ago
O' Great Lord, may your noodley appendage save us all from global warming, Ramen.
Sumuois 2 years ago 4
ramen
grupoetv 2 years ago
Oh God ^:)^
xSonOfPersiax 2 years ago
wow the reson fot the exsistice of humanity! rAMEN!
sonofjaybirdswind 2 years ago
:O Amazing!!! RAmen!!
KokuYoku147 2 years ago
Comment removed
KokuYoku147 2 years ago
RAmen
warning746 2 years ago 2
May everyone be touched by his noodley appendage.
nhojmabon 2 years ago 3
oh man i just hope chef boyardee is a creationist...
herolink0 2 years ago
This comment has received too many negative votes show
how dare you use mozart... you piece a shit
herolink0 2 years ago
RAmen
don´t forget on 19th .9 is talk like a pirate day
ARRRRGHH
TheMongoKing 2 years ago
You forgot the lady and the midget!
C0mmanderMB 2 years ago
the midget is at 0:20?
azsxdcfvgbhnjmhn 2 years ago
didnt look like a midget
C0mmanderMB 2 years ago
q lindo!
3Hygeia3 2 years ago
This has been flagged as spam show
The entire point of Intelligent Desing is that the cosmos was made by an IMMATERIAL, SUPERNATURAL, ALL-KNOWING and ALL-POWERFULL entity, in other words, something DEVINE.
The Flying Spaghetti Monster does not qualify since it has none of those characteristics.
Get a clue Atheists. Try this rather than your FSM childishness :
watch?v=pJotUb4AfnU
watch?v=Kz6vYo2ZzvQ
watch?v=_v_SQJFPItg
Durandal1492 2 years ago
Um, no.
Actually, Intelligent Design simply is attempting to advocate the notion that a designer of some sort was responsible for specific aspects of our biology. It says NOTHING about the origin of the universe.
Either way, it is rubbish no matter how you cut it. Simple concepts for simple minds.
Diomedes01 2 years ago
It's DIVINE you illiterate, bible bashing, child molesting wanna be priest.
CharlieWhitesWig 2 years ago
you are very ignorant. i would like to enlighten you. msg me if u seek knowledge and a more perfect truth.
UnluckyGambler 2 years ago
lol, this is awesome. I thought FSM got drunk tho
Zando24 2 years ago
So Cute ^////^!
xNaRuToLoVeRx 2 years ago
oh God! your divine tentacles RAmen!!!
ACMaiden 2 years ago
RAmen!
rubyroseoftheriver 2 years ago
That looks exactly what the 'bible' make of creation... full of BS.
Nicely created visual though ^.^
musicvideospecia 2 years ago
Ramen!
Lsbury 2 years ago
Well, FSM kinda makes sense...
Pasta does taste good. The idea that FSM covered up his YEC tracks, and falsified the fossil records, makes more sense than other religious explanations. And pirate clothes are cool.
Okay, i'm in.
Elvisdogg 2 years ago
Lol LOVED the midget...
Diimalot 2 years ago 2
Ramen
Arakash 2 years ago
Ramen. whilst watching this video i feel that, not only has the FSM touched you with his noodly appendage, you have touched me also with YOUR noodly appendage. FSM bless you, brother.
anglaismoyen 2 years ago 3
Now I know the truth!
HitMeWithIt 2 years ago 2
RAMEN and very cool, but the first human being created by the FSM wasn´t a female? Peace from the pastafarian atheist branch.
DragonBorracho 2 years ago
The first human on the mountain with trees, was a midget.
themightychickens 2 years ago
This comment has received too many negative votes show
OP is a faggot
sync380 2 years ago
RAmen
kc28kenneth 2 years ago 4
Well done Pastafanarian brother, it is evident that you walk the true plank and walk it well.
This is a great tool in helping others see the truth in the noodles.
Carbo Deim
Ramen
tSloan92 2 years ago 5
I was touched by his noodly appendage and I have been saved! All praises to his holiness the Flying Spaghetti Monster! RAmen!
canadianmaple09 2 years ago 3
SONG
dardraa 2 years ago
All hail is noodly appendages ... (R)amen
jackprince1983 2 years ago 2
I love the sound effects. "Bloop!"
LanceDirk 2 years ago
Praise his noodliness!
Floydthefuckbag 2 years ago 3
Thi proves that I was right and the meaning of life is spaghetti.
RickyRaptor 2 years ago 4
LMAO love the music and the sound effects. I also love your name, "vivalareason."
RAmen
p.s. I had some Ramen noodles at 2:30 am, and they were delicious. Praise and chomps to his noodly appendage!
Beeza2996 2 years ago 2
so THIS is how the earth was made
Klaorvieer 2 years ago 4
Well, there it is: proof that God created the universe. And that FSM is the one true God. Take that, Christians!
787Bisurdaddy 2 years ago 4
lol!
piratedebo 2 years ago
god bless Atheism :) sorry FSM
nemoein 2 years ago 4
Do we need a manifestered evidence?
MAy the holy Pirat DAVY JONES, his delicious noodleness highest avatar, take all believers over the endless sauce stream and into HIS arms
RiiNagaja 2 years ago 3
thats one freaky spaggetti monster..... D: RUNNNN
InsertGoodNameHeree 2 years ago
Nice!
Wladek89HU 3 years ago
This is the true god, and this is as he created the universe.
Imhornydadcomeinside 3 years ago
RAmen
KevinJ8 3 years ago
I AM A PASTAFARIAN !!!!! PASTA AKBAR
fabianv94 3 years ago 3
i'm converted!!! :D
ThePereginPigeon 3 years ago
RAmen
Animelover1465 3 years ago
RAmen.
nic0dice 3 years ago
i always imagined it to be more spaghetti-y
forsbrookme 3 years ago
I was a non-believer, until I saw this video. Now I'm a convert and the FSM is part of my life. I will pray for those who still don't believe because the end is near.
Flying Spaghetti Monster bless you. Al dente of course!
FartVandelay 3 years ago
Ramen
vgeo79 3 years ago
Very powerful and deeply moving, especially at Christmastime! It's nice to see true spirituality using animation and the internet to spread the word of His Noodly Appendage. If only they will teach Pastafarian Creation in the churches alongside that other stuff, the way the Xtians want their religion taught alongside the science of evolution, more people would be enlightened. But the FSM works in mysterious ways, and I'm eating pasta for dinner!
wildeknights 3 years ago
watching this video may have been one of the most exhilarating and religiously inspiring experiences of my entire life.
XcaptainXobliviousX 3 years ago 2
You lying with this video. TAKE IT OFF YOUTUBE HEATHEN! GOD made the world by makings pop up out of nowhere with no scientific explanation [although we now have scientific explanations for them]
plus you left out the part where god made the fossils and fought santa claus and constricted him to the north pole where he is only free for 1 day of the year and he uses it to bribe us to believe in him with gifts.
To children esepecially, as form of childhood indoctrination....
ambir 3 years ago
Also, that's English. Not ancient Greek, or Latin, or whatever. English, with no vowels, punctuation, or spaces. By your standards, as you are an excellent English speaker, you should be able to translate that exactly as I intended it.
KatherineCullen 3 years ago
You seem really smart, but I don't know how I could make this any more clear. You can translate things correctly and still have them say different things, like the very first examples I gave [GDSNWHR, No pets are allowed].
Are you purposefully sidestepping my points?
Seriously.
KatherineCullen 3 years ago
well i understand your points very well, actually i am very interested in your points, i have to know ancient greek to make a conclusion, i do understand your point! thats not the problem, but you dont know ancient greek well enough to pinpoint a contradiction in the translations. i would ask a expert, like my pastor, he took ancient greek and liberty universtiy, i should ask him.
jtmseals12 3 years ago
You're still sort of missing the point. Here:
TDSNTRLLYMTTRTHTTSNCNTGRKSMCHSTMTTRSTHTHLFTHLTTRSWRLFTTFNNTRTXTYSTLLDNTNDRSTNDTHPNTVBNMKNGTHSNTRTM.
Translate that, and then let me know if you understand my point.
KatherineCullen 3 years ago
katherine... i know this may sound mean, but you dont know greek and neither do i, so lets ask the expert! you are arguing about something that you have minimal knowledge about! ask the experts not me, lol
jtmseals12 3 years ago
I keep telling you, it's not about the ancient Greek.
Hmm. I don't know if you got that comment I left earlier; it appears to be gone. I wanted you to translate this:
ITDSNTRLLYMTTRTHTTSNNCNTGRKSMCHTHTTMTTRSTHTHLFFTHLTTRSWRLFTYFNNTRTXTYSTLLDNTNDRSTNDTHPNTVBNMKNGTHSNTRTM
It should be no problem, as you're an English speaker and should understand that as well as people that know ancient Greek understood the ancient text.
And it didn't sound mean, it sounded ignorant.
KatherineCullen 3 years ago
OMG...lol wow, OK let me say again, u dont understand ancient greek to translate it, i dont understand ancient greek to translate it! a lot of english speakers dont understand ancient greek to translate it. BUT THERE IS A SLECT FEW THAT KNOW THE LANGUAGE, AND CAN UNDERSTAND IT AND READ IT, even without spaces! thankyou! lol
jtmseals12 3 years ago
IT'S NOT ABOUT THE ANCIENT GREEK. IT'S ABOUT A TEXT MISSING HALF ITS LETTERS.
Okay, there are masters of ancient Greek. Check. They can translate text. Check. There is, however, no way to know if what they translate is exactly what was intended! You're a master of English. You could translate the text below. What I'm saying is that you can't be sure that what you translate is exactly what I wrote.
I take back what I said about you seeming smart;; you're kind of stupid.
KatherineCullen 3 years ago
oh geez now you are insulting me, lets take a step back. ok now we understand that you know very little about translating any language with no spaces, check. ok, there are a vast amount of people that know ancient greek and have confirmed its accuracy. The scribes in the biblical days were so anal about copying the bible, they broke the utensil every time they wrote God's name and took a bath. Plus, if there were any mistakes, they would simply throw OUT THE WHOLE SCROLL! =)
jtmseals12 3 years ago
I'm not talking about mistakes;; I've never been talking about mistakes. I'm talking about discrepancies and commentary. Translating something, no matter how "accurately", still leaves room for discrepancies, which is known as commentary from the individual translators. Biblical text was first of all told through many generations and wasn't the same exact story as it was when it was first told. It was then written down without vowels, the individual texts were reviewed at Nicea and some texts..
KatherineCullen 3 years ago
were left out. It was then translated and retranslated and then translated into what we have today. It is not exactly what was written down, nor what was told originally and definitely not what actually happened. It is therefore not a reliable historical reference, which is all I've been saying this entire time.
KatherineCullen 3 years ago
lol ok i get you until the reliable historical reference part, i do understand that languages have differences between grammer. i understand that what we have today is not exactly worded as back then. thats why we have scholars that justify the credibility. if you know ancient greek and say that there is a translation problem then i would be fine, but you dont know ancient greek. its like me criticizing a book that i haven't read, i would have to read the book first to criticize it. cont.
jtmseals12 3 years ago
I'm sort of confused as to why we're even talking about Ancient Greek... Wasn't the original manuscript written in Hebrew?
KatherineCullen 3 years ago
I mean, the Old Testament at least.
And I can give you a lot of discrepancies in the Hebrew of the Old Testament.
KatherineCullen 3 years ago
well actually there were manuscripts written as soon as 10 years after the resurrection. Plus, there is a incredible reference of history, in fact, if you truly study history, you will find out that Luke (the writer of Luke and Acts) was write and the historians were wrong. ex. in Acts 18:12, it says Gallio was proconsul of Achaia, WHAT proconsul... the later historians did not refer him as a PROCONSUL, so historians thought that he had made a mistake. BUT CONT.....
jtmseals12 3 years ago
He was only proconsul for a year, and in the ancient greek/roman times, there wasn't enough documentation to expect historians from years later to be aware of things that happened fleetingly in places that weren't really that important in the scheme of things.
KatherineCullen 3 years ago
haha EXACTLY!!! ALL THE HISTORIANS MISSED IT LATER ON CENTURIES LATER, BUT LUKE DID NOT MISS IT..... SOOOO THIS MEANS TWO THINGS..
one he is very anal about detail and not leaving anything out
two he to remember something in such detail, Luke had to write LUKE and ACTS in the early 1st century!
Yes the old testament was written in Hebrew, or i believe most of it. lol idk how we started talking about Ancient Greek, lol haha But the whole new testament was written fully in Ancient Greek.
jtmseals12 3 years ago
Well your first point doesn't make much sense... Yes, he included something he knew that other wouldn't know years later... That doesn't mean he didn't leave anything out. Sooo yeah.
And were we ever arguing about your second point? ...No.
I'm pretty sure I was all "The bible was written without any vowels or punctuations" and you were all "I don't know Ancient Greek, do you???" And we then applied everything we said to ancient Greek.
...rofl.
KatherineCullen 3 years ago