yuuyu5u54yu54y6tt2365yt7yyyuyuuuuuk,uukukujtgfhykhkhkhkyfnjhk-0;plup[uo0o;opotoyttyiityitiytiu5i5i8uyiui6iu6u6uu5866iirieu4343ueh5jrerdhgbegeghegergegevwewcqcqwddfhthtthy?thhdhdfdghduusysdghhyrhryryhrtjejrrjjyrjkttttrjtuerjr44ruyeryhryryryterurtutuhrhjjtjjttytyjttjhthyhttjththtttt I’m typing well the song is playing!!!!!!!! :)
@MrFalloutaddict I am confused. Wikipedia says: "π is an irrational number, which means that its value cannot be expressed exactly as a fraction having integers in both the numerator and denominator. Consequently, its decimal representation never ends and never repeats."
@eretrece It does end, seeing as we know a number longer than it which has an end certifies this. It may certainly be a supposed never ending number, but really it can't be as then there would be no real answer to the circumference/diameter as it would be infinite, so the sum would be incomplete. It's hard to grasp the concept of such a long number so it's easier to say it goes on endlessly rather than saying it has so and so many decimal places.
this isnt all pi because even the song couldnt name all the numbers. btw the people who say pi doesnt end then that means pi is infinity. people even say pi is wrong. i say tau is different.
@Palmer640 Bitch please, I recited it backwards while writing from -infinity to zero with my left hand and typing from zero to infinity with the right hand. I did that when running on a treadmill. I ran to the end of it, if you must know.
i swear this video is trying to tell me something...... OMG IT IS A RUSSIAN TRANSMISSION SAYING THAT THEY WILL DESTROY THE WORLD USING SEAFOOD AND BISCUITS! lol jk
Pi is 9858495049395489284038430493049309430495309584678974094739549504594854059409530-59305930954059406940545-4954905945409545o0454940540540-54-54594-545454095409584964960485395454309759487589475843957438457357370534845375943584 AHHHHHHHHHHHHHHHHHHHH!!!! (the world explodes)
I hear words like "hair", "Zeus", "Narnia", "worse", "words", "Fuss (German for "foot")", "smoking", "false", "ear", "never" and "wolf" hidden in this. Am I going insane, or can other people hear them? o.o
@awesomeatron123 well, there is a theory that says infinity does have an ending, but the distance between the begining and end is infinite, so the end, or begining cannot be reached by crossing from the other
and quit being a know it all, this was just for lolz
You can round anything how old are you im 14 and i know you can round anything say to the fitst significant figure or to 1 decimal place so dude you are wrong
Wait if pi is infinite then how do they say it backwards?? And now it's time for a weird brain buster: What is the last digit in Pi? Please reply with your answer.
pi is -12292988918121921898312912938129031928371283468427720374932743927493274932874274329874397432984723962953869170572319095642957625r62435735730928593827598265984465p9743292759275098275098236509824619073218709827145-28437598475843728572984754982379857 AAAAAHHHHHHH *head explodes*
There was comment that said Pi was one helluva password. I beg to differ. THIS is one HELL-OF-A-PASSWORD (mostly because no one but Chuck Norris knows the end of Pi, and it's the password to his house). How do I know? Well I don't. It might as well be an imaginary number that's the password to his house.
more random words for never smooch non valve no wall tsk tsk no words wooshskts now now never snap schools por (no worries no fear) fofo its ok wooshkskish never receive no world no no cow que val? there is no no walkway Pinocchio never ski no peep there is no assist Smokey Swiss seeow OMG
random words in here (possibly) moose no no worries cow moose skish meow noise snow nom bee south foosh never nobel no assist no kiss now sushi que no fear WTF!?!
omg, backward lyric: efasgagsfiihgsiadfiahifojiasdhfgusxfjghaQeaersdarfads !!!!!!!!!!!!!!!!!
hugoo645 3 days ago
the 60's are back..
wilberry7 4 days ago
i heard feed my wolf in backward version
elliot10849278741 5 days ago in playlist Liked videos
transcribe audio. LOL
TheNigaHo 5 days ago
MASON WHAT DO THE NUMBERS MEAN!!!
joe122295 1 week ago
THE NUMBERS! WHAT DO THEY MEAN?
hschlick1 1 week ago
turn on the cc thing
cowboymarchingband1 2 weeks ago
sounds catchy
FlagueDehman 2 weeks ago
This sounds similar to what happened that time I successfully divided by Zero
RaveriusMax 2 weeks ago
It sounds like she mentioned "fail" in it. :P
Halo44327 2 weeks ago
i'd swear i heard nyan nyan nyan somewhere. nyan cat is everywhere.
shanniesaur 2 weeks ago
Wouldn't it be The Ip Song, then?
TheSpeedOfStupidity 4 weeks ago
Now THIS is the INTERESTING version...!
MOONSIP2 1 month ago
I hear Nyan nyan. Is this a REALLY weird version of Nyan Cat?
SynchronizedCarCrash 1 month ago
Sounds german?
musicmakeupmoda 1 month ago
1:05 It says "Elves say smoking."
dominoboy08 1 month ago
An then cell phone
bttfjulesvernemarty 1 month ago
First when backwards it says old yum yum yum
bttfjulesvernemarty 1 month ago
this video.. IT SUCKS MY SOUL AWAYYYYYYYYYYYYYYY!
Snakebyte20 1 month ago
Chuck Norris knows how this REALLY starts.
Molybdaenmornell 2 months ago
cool
hellochannelbonjour 2 months ago
chuck norris:i can translate that for ya
sgtmaxhigdon 2 months ago
Sounds like simlish. (the language they use in the sims games) OH MAI GAWD I wonder if it'd sound like english if you reversed simlish... O_O
Raenoleah1014 2 months ago
The Aliens Have landed!
or
!dednaL evaH sneilA ehT
Bmroland11 2 months ago
0:36 "omnomnom"
VZabe 2 months ago
yuuyu5u54yu54y6tt2365yt7yyyuyuuuuuk,uukukujtgfhykhkhkhkyfnjhk-0;plup[uo0o;opotoyttyiityitiytiu5i5i8uyiui6iu6u6uu5866iirieu4343ueh5jrerdhgbegeghegergegevwewcqcqwddfhthtthy?thhdhdfdghduusysdghhyrhryryhrtjejrrjjyrjkttttrjtuerjr44ruyeryhryryryterurtutuhrhjjtjjttytyjttjhthyhttjththtttt I’m typing well the song is playing!!!!!!!! :)
vwerlingyahoocom 2 months ago
Ip.
:D
SuperAimstermikumiku 2 months ago
?sdrawkcab ip draeh reve uoy evaH <- LOL
AATTOOMMBBOOMMBB 2 months ago
@AATTOOMMBBOOMMBB did i sey
b3stgl1tch3r 2 months ago
OMG...it started sounding like a cat
125ZeroGrav 3 months ago
Wenn man da n ordentlichen Beat hinter macht, hat das n groove xD
Daniel90923 3 months ago
push push words down your ear? O.o SNAIL IN MY EAR?! PUSH YOUR MOUTH FULL?! o.o this song is full of bad manners
rockoutchick1 3 months ago
@rockoutchick1 meow meow meow meow
432Chocolate 2 months ago
wskwushwushthereisnowolfwushwushnofearwhushushjklhthereisnowolsfushgewushwushwush OMFG I LOVE THIS SONG
rocklover142 3 months ago
Comment removed
rocklover142 3 months ago
Press 6
"Let us know no words let us know no fear"
addictedtodoom 3 months ago 2
cool a new language
purplefanadic234 3 months ago
iq. There, i did it.
CamTroid 3 months ago
Why do i hear german numbers like zwolf, eins, vier, funf, sech, zehn ect?
JuJu84B 3 months ago
War is the best solution?
BlackCatsCrossing13 3 months ago
how did u know where to start lol
therealjordiano 3 months ago
there is no word in this
oddyslay 3 months ago
"noise", "no love" xD
djmati111 3 months ago
WTF I HEAR WISKY! :o
Camicapas 4 months ago
I can keep hearing nom nom nom nom! Pi is eating pie!
awesomelightning 4 months ago
No you can't hear pi backward because pi is infinite.
yummy791 4 months ago
@yummy791 Actually, it isn't. Grahams number is MUCH longer and we know how that ends.Pi is very long but not infinite.
MrFalloutaddict 3 months ago
@MrFalloutaddict I am confused. Wikipedia says: "π is an irrational number, which means that its value cannot be expressed exactly as a fraction having integers in both the numerator and denominator. Consequently, its decimal representation never ends and never repeats."
eretrece 3 months ago
@eretrece It does end, seeing as we know a number longer than it which has an end certifies this. It may certainly be a supposed never ending number, but really it can't be as then there would be no real answer to the circumference/diameter as it would be infinite, so the sum would be incomplete. It's hard to grasp the concept of such a long number so it's easier to say it goes on endlessly rather than saying it has so and so many decimal places.
MrFalloutaddict 3 months ago
Nom nom nom?! WTF?
Pi is hungry xD
Fynn168 4 months ago
this isnt all pi because even the song couldnt name all the numbers. btw the people who say pi doesnt end then that means pi is infinity. people even say pi is wrong. i say tau is different.
lilroz44 4 months ago
Well, it's already been said, but still. Saying Pi backwards... Well, count from infinity to 0. It's similar.
WhynotMiha 4 months ago 33
@WhynotMiha u got a point there, mate...
HarmKnight 1 month ago in playlist Meer video's van TheSoupAndPie
I recited pi backwards and counted from infinity to zero... Twice.
Palmer640 3 weeks ago
@Palmer640 Bitch please, I recited it backwards while writing from -infinity to zero with my left hand and typing from zero to infinity with the right hand. I did that when running on a treadmill. I ran to the end of it, if you must know.
WhynotMiha 3 weeks ago
@WhynotMiha Woah, now that's tough!
Look I don't want no trouble now.
Palmer640 3 weeks ago
Aliens communicating.
TedWang2 4 months ago
does it say war is the best at 0:32 ?
iHaeTypz 4 months ago 2
Press 5 to hear lemon soap
sazhchocobo 4 months ago
@sazhchocobo yes
portalfox1 4 months ago
press 5 for 'never soaps'
DeMiDayDreamer 4 months ago
Let us know no words, no fear!
Kelarre653 4 months ago
This has been flagged as spam show
0:36 nom nom nom XD
AikoSeeno 4 months ago
0:32 nom nomers? xD
AikoSeeno 4 months ago
omg did u jus recorded one wif random words inside? or r the greeks playin some kind of trick on us which we didnt noe for thousands of years
MagicalMusicBox99 5 months ago
i swear this video is trying to tell me something...... OMG IT IS A RUSSIAN TRANSMISSION SAYING THAT THEY WILL DESTROY THE WORLD USING SEAFOOD AND BISCUITS! lol jk
awesomeatron123 5 months ago 37
@awesomeatron123 I agree, however, the message states "We will destroy the west using russian turnips!"
SlayerHead113 1 month ago
@awesomeatron123 ORLY YOU WERE KIDDING?
Jacen47 3 weeks ago
@awesomeatron123 Don't you mean using Soup and Pie?
owennewo14 2 weeks ago
@awesomeatron123 so russian has nuclear weapons they could use on us and instead they use seafood and biscuits? clever russians!!
HeyShay43 5 days ago
@HeyShay43 haha lol clever indeed.
awesomeatron123 5 days ago
nyan nyan XD
MarciSzabolcs92 5 months ago
so...this song is actually full of subliminal messages???
ihaveanerfgun 5 months ago
o_O
semolina323 5 months ago
hells speech !
MrDDBT 5 months ago
0:30 First "Nom Nom" LOL
iPlayGames234 5 months ago
press 7 - we never serve seafood
press 5- never sold biscits :D
MrSFV818 5 months ago
School starts soon...
MegaGTAzocker 5 months ago
If u press 9 it says, non valve, no wolf, no, no beer. Any idea what that means. lolXDXDXD
awesomeatron123 5 months ago
1:00 NYAN NYAN
hlupaco 5 months ago
ip
kindafunnyshow 6 months ago
Syntax Error. KABOOM
xaminmo 6 months ago
FOOL!! YOU KILLED US ALL!!!!!!!!!!!!!!!!!
armorgamsees 6 months ago
at the very end starting at 1:26 I hear "No wolf, no, no beer..."
PokemonjonasDS 6 months ago 2
Hope you can't understand it because your brian will explode
WindowsMaster1985 6 months ago
Pi is 9858495049395489284038430493049309430495309584678974094739549504594854059409530-59305930954059406940545-4954905945409545o0454940540540-54-54594-545454095409584964960485395454309759487589475843957438457357370534845375943584 AHHHHHHHHHHHHHHHHHHHH!!!! (the world explodes)
WindowsMaster1985 6 months ago
3.1415926535897932384626433832795028841971693993751058209749445923078164062862089986280348253421170679 8214808651328230664709384460955058223172535940812848111745028410270193852110555964462294895493038196 4428810975665933446128475648233786783165271201909145648566923460348610454326648213393607260249141273 724587006606315588174881520920962829254091715364367892590360011330530548820466521384146951941511609
ReachOverable 6 months ago
I sang this song and went to hell.
clearimage101 6 months ago
@clearimage101 I also summoned Satan while I was at it.
clearimage101 6 months ago
Pi backwards = Ip
thatlookscool 6 months ago
0:33 - 0:35 There is no wolf!
hlupaco 6 months ago
if you like this video than you will defently love my video called kitty ka pow episode #1 kittens for sale! pls go to it.
MrKittytoenails 6 months ago
no fear, no worries, no world.
cjlgld 6 months ago
some kid some where, just exploded as this was there destruction sequence code. [American Dad Reference]
Kunesume2 7 months ago 2
She says 'no hope' one time. :O
DeMiDayDreamer 7 months ago
near the biginin u can her "NOM NOM"
Conorsawsome 7 months ago
What's next, dividing by zero backwards?
MrCorpseGrinder88 7 months ago
nom nom nom
SuperSamcity 7 months ago
@brblolkk Could this be a secret to unlocking the secrets of the universe?
cowc0w6 7 months ago
*goes back in time*
Mymariodude 7 months ago
I hear words like "hair", "Zeus", "Narnia", "worse", "words", "Fuss (German for "foot")", "smoking", "false", "ear", "never" and "wolf" hidden in this. Am I going insane, or can other people hear them? o.o
brblolkk 7 months ago 23
@brblolkk some of the words,'Narnia' for example,i heard,too
Avalonia87 7 months ago
@brblolkk yea, and forrest and "nom nom" (sound of eating) LOL
lol4U1000 3 months ago
pi is infinate you cant say it backwards
gunslinger550 7 months ago
0:30 Nom nom :D
IzehGIR 7 months ago
Half of this sounds Russian.
Achiox 7 months ago
@Achiox ur right
Mymariodude 7 months ago
U CANT SAY PI BACKWARDS. if u could it would mean that there is an ending 2 pi which there isnt.
awesomeatron123 7 months ago 93
@awesomeatron123 acctually there is its like 70 trillion latter
letterljl 7 months ago
@awesomeatron123 well, there is a theory that says infinity does have an ending, but the distance between the begining and end is infinite, so the end, or begining cannot be reached by crossing from the other
and quit being a know it all, this was just for lolz
namekman01 7 months ago
@awesomeatron123 It's the song backwards idiot.
Koloszrodosthe 5 months ago
@awesomeatron123 actually it does end and it ends with 11595628!
tsilybjt 5 months ago
@tsilybjt WTF! you my friend you are stupid!
beaners3X 5 months ago
@awesomeatron123 Wow, you must be like an... scientist.
morten1993 5 months ago
@awesomeatron123 it has ending becouse it is backward,worst thing is that there is no begining in backward :\
NenadKebic 4 months ago
@awesomeatron123 Pi backwards is iP. It's pretty easy to say.
SlugDragon 4 months ago
@SlugDragon haha lol.
awesomeatron123 4 months ago
@awesomeatron123
i can: ip
mcweaky 3 months ago
I swear, there's a Satanic message in all of that
88Meters 7 months ago 2
Lol, good luck finding the end of pi so you can go backwards.
CraigIsAnEgg 8 months ago
ANTI-PI
thisismyname1920 8 months ago 2
PI song normal is for the smart people. due to this backwards. its for the dumb people
gamewebcam 8 months ago
press 5 for he never saw bisscuts
downsHG3 8 months ago
PRESS 7 and it SAYS :HE NEVER SAW SEAFOOD NUM NUM
goonerO2 8 months ago 2
@goonerO2 haha lol
awesomeatron123 5 months ago
press 4 and it says, fear no words no fear words of non valve fear of if each of us know we whisper escape outward...
electromoo 8 months ago 2
@Eric101point101
You can round anything how old are you im 14 and i know you can round anything say to the fitst significant figure or to 1 decimal place so dude you are wrong
reptiles2096 8 months ago
Wait if pi is infinite then how do they say it backwards?? And now it's time for a weird brain buster: What is the last digit in Pi? Please reply with your answer.
tacoterminator 8 months ago
@halloforigin dude,you cant round it to anything,its INFINITE
Eric101point101 8 months ago
my new ringtone!
Ezme56 8 months ago
press 6 and it says, let us know no words no fear
417Guardian 8 months ago 41
@417Guardian OR Vanilla Snow
fs11klrk 7 months ago
@417Guardian it dus thats scarry
violentwilly 5 months ago
OMG DID YOU HEAR THE ILLUMINATI MESSAGES???? XD
Anakin8th 8 months ago
Kreepy
gmod576 9 months ago
this is wrong, you can't say pi backwards, you have nowhere to start, its like saying 15,743 backwards is 751
Dahxelb 9 months ago
this is chuck norris's power level
tombbot 9 months ago
there is only one problem, it is impossible to say pi backwards as pi is an infinite number which means it has no end to start from.
31nar288 9 months ago
@31nar288
It's also impossible to say pi forwards if you think about it. He means rounded to the nearest millionth.
TheLuigiRocks 9 months ago
@TheLuigiRocks you cant round an infinite number to the nearest millionth dumbo
Eric101point101 9 months ago
fuckin amazing
crazyravingthing 9 months ago
nom nom nom
legomaster335 9 months ago
Pi=17656237456374285632456734563535435327856452723456284672845627862375867258563278652738456237485678324653756738246578239563275643756325732753267458657326754326847645276357263758624566546767900341423423141241234214234235645645263156466797046783, Basically it's the matrix
2000autobot 9 months ago
pi is -12292988918121921898312912938129031928371283468427720374932743927493274932874274329874397432984723962953869170572319095642957625r62435735730928593827598265984465p9743292759275098275098236509824619073218709827145-28437598475843728572984754982379857 AAAAAHHHHHHH *head explodes*
sharptooth777 9 months ago
:O! talking jibberish!
BadAngelLoveMe 9 months ago
0:33
"Fuck you"
O_O
axellekiller93 10 months ago
It sounds like it's in Japanese...
SuperRhyolite 10 months ago
sounds like a japanese commercial to me.
The1ryan231 10 months ago
Chuck Norris can count Pi from the end.
xXFinnishRainbowXx 10 months ago
Since we don't know the end of Pi, how can you let it go backwards O.o
friction1986 10 months ago
touches my soul!!
BlueMoon9329 10 months ago
I herd a couple NOM NOM NOMs
Eric69418 10 months ago
sounds foriegn
BlueMoon9329 10 months ago
which number doesnt go with pi?
5, 7, % or 9000?
reply which one u think, (NOOOOOOOOOOONE should get this wrong)
mikeflash2160 10 months ago
@mikeflash2160 Ummmmmm.... is it pikachu?
indyjon3s 9 months ago
0:44 - 0:45
meow meow
Ladybugg2000 10 months ago
i heard............
sha na na foots itch oh sha na na foot foo loo ha
BlueMoon9329 10 months ago
This is how Vagineer recites Pi.
FoobyZeeky 10 months ago
There was comment that said Pi was one helluva password. I beg to differ. THIS is one HELL-OF-A-PASSWORD (mostly because no one but Chuck Norris knows the end of Pi, and it's the password to his house). How do I know? Well I don't. It might as well be an imaginary number that's the password to his house.
hbar45 10 months ago
spɹɐʍʞɔɐq ʇı ʎɐs oʇ ıd ɟo puǝ ǝɥʇ ʍouʞ oʇ ǝʌɐɥ noʎ ¿ƃuos sıɥʇ sı ʞɔǝɥ ǝɥʇ ʇɐɥʍ
neocube216 10 months ago
LOL that sounds like someone's singing it in a foreign language.
dnlperlin 10 months ago
I heard om nom nom nom. IS THE SINGER A HEAVY!?
balanceblade100 10 months ago
you can't recite the digits of pi backwards. Pi is an irrational number consisting of an infinite number of trailing digits that do not repeat.
dgjiephfurreighR 10 months ago
G54Wins 10 months ago
G54Wins 10 months ago
Kept saying moose
ThePringlegod 10 months ago
backwards sounds like chinese/japanese
i0am0mik0so0are0you 10 months ago
I hear "no worries" a lot.
TrueGamer181 10 months ago
Did i hear snookie want smoosh smoosh??? 0-o
JasonChang55 11 months ago 2
Common words:
Sushi
Food
Cow
Bee
JasonChang55 11 months ago
@Gdigger10 this is what i learned when I was 11: 3.1414926535897932384626433832795
ASSNEWSOFFICIALCH 11 months ago
This has been flagged as spam show
Lol it keeps on saying sushi
anatony11 11 months ago
This is impossible because pi never ends, so it cannot be recited backwards.
cyndie26 11 months ago
282315680841289760711243528430826899802682604418703295449479028501573993961791488205972383346264832397985356295141.3
Jasperfritse 11 months ago
Much Better....
What Language?
flufftart1120 11 months ago