osea de aki s q vienen los chistes de Chuck Norris!! esta cancioncita recien la scucho... con razon amigos d Spaña siempre decian esos chiste :( del Chuck norris :D
Chuck Norris is gay cos if he wasn't then he'd come round my house and smash my head of the keyboard sakshfgsdfgsdhgvfsdgvfcjksdhvcfjkhsdvcjkhdvsjkcvsdhkgcvkzxvcghzxvcgvczbxv chvcghvhcvghvchgvchgzxvchgvchvcgxvcgxvcgvgcvhxvgzcxggxghgudyeytruyrtuwyteruyetuygdhvvvvvcxvcxvxhgvfdysdfasftfafttqqftfwtfwtgdvsvsdbbbbgvfdswertyuioppolkjhnbvgfdreswdfghbhgbhtgfvbhytfrvbhygtbnhygbnhjygbnjiujikioooooooooooooopoiuytrewqasdcfvghygbhygbhuyghbhuyhbghjuhbghjhbhbnhjhgbhjhgbhgbhbhbhbnhbnhjhbnhjhbnjnhj
He isn't dead and how many of you true Chuck Norris fans actually know that he confessed Jesus Christ to be his Lord and Savior on live tv? (: awesome stuff!!
Peace Be Unto All 22 Nations Of Humanity And A Blessed New Year And World Peace For All.
I Bring Unto All Of Humanity The Real Revelation Of St John The Divine, The Return Of The Morning Star In 2012. And The Judgement Of All 22 Nations Of Humanity And Mankind Moreover To All Members Of Power Free All 22 Nations Of Humanity From Your Wicked And Vile Evil Ways...Repent For Your Sins Ask For Mercy For The Time Is Near A Must See At My Site On You Tube Thanks For Watching Enjoy And Be Free In 2012.
To build muscles like that you would need protein you get Whey Protein products and other supplements at best price at iherb.com if you use the referral code daj756 you get 5% off
Fuck you guys with all of your stupid Chuck Norris jokes, if it was all true why doesn't he come here and bang my head on the keybfjirkjg ù*mre$^ rekjfeo'" ^l$^rlezef
all youtubers come and check my channel, and get inspired by a genetic gifted great natural bodybuilder just come and check it out, u don't have to comment or like if u don't want , but just come and check it out plz
este video es una porqueria no es ni gracioso ni interesante solo perdi 3minutos con 34seg de mi tiempo tirados a la basura si van a subir videos por lo menos suban algo buen..... no pendejadas buuuuuuuuuuuuuuuuuuuuuuuu......
If this is your music?! If this is what you like?! If this is part of your life?! Then pick up your phone and call us today. Order our latest album called "duras pelotas afeitado" (translated: hard wellshaved balls)!!!! Call now, our phonenumber is: 0121123-637289305932348234 ........
Did you know that using STEROIDS can interfere with fertility, ability to sustain erections firmly, and completely demolish your body's natural hormone balance?
Excess testosterone is converted to estrogen, so many ROIDERS have to use estrogen blockers to rid the extra estrogen out of them(male ones usually).
On top of this, they must constantly balance other agents, and other unhealthy, unnatural DRUGS to keep their body the way it SHOULD be WITHOUT DRUGS!
yo ppl check out my vids im a natural just turned 21. i wanna know where i can improve cuz im hopefully competing, so i would appreciate the support and advice. safe
also i think 1,812 people just got roundhousekicked into their computer monitor by chuck and i will click like so i am safe (i know what happens when you click dislike wonder what happens when i click like?)
wats with the hype on chuck norris he aint even that special . yes if i fought him one on one id loose but if i had a gun then his dumb ass would loose he aint that special
the origianal name was alians vs preditors vs chuck norris but then the producers realized no one wanted to watch a movie that only lasted 45 seconds, check us out and subscribe or comment
okay, i know this is supposed to be "funny" but the beginning really pissed me off! CHUCK FREAKIN NORRIS is NOT JESUS CHRIST! JESUS CHRIST IS THE SON OF OUR LORD AND WE NEED TO RESPECT THAT!
WTF chuck norris is a dumb actor if he's a god he will instantly teleport into my back whacking my head into the keyboarddmaksldnhajkslhdgkjxzbcnxzcbisahdwqhqaduiwgqdakszcgbnxbvhsgfkhgsdhsgadasf
Who the fu*k this Chuck Norris, when he really would be that great, he would come to my house and hit my head on the keybogwziegFVLVZFVWEZLVZLVZLvzlvzuvzulvwegzilFVGZIEGWZIWFGE97076w0%F&(TR&W(%&F%)&R%%&RFE/)67fr
chuck norris fuma a boca
HuzkeyBlack 7 minutes ago
chuck norris invento la palabra Gay. < chuck norris invented the word Gay.
arieljd1 9 hours ago
lol Chuck Norris as buckethead! :D
Thewarchaserss 15 hours ago
.... im in that weird part of utube again....
Gunsmith1994 20 hours ago
What is the meaning of this video? uploader please answer if you can ...
hytleer 22 hours ago
2000 dislikes, Chuck Norris is coming you!
topinfokz 1 day ago
osea de aki s q vienen los chistes de Chuck Norris!! esta cancioncita recien la scucho... con razon amigos d Spaña siempre decian esos chiste :( del Chuck norris :D
FERMATCHenHD 2 days ago
Im sick of u little douch bags making those gay chuck norris jokes y dont ya get a life thumbs up if u agree
codfreak2816 2 days ago
Comment removed
DrMILFHunter 2 days ago
This has been flagged as spam show
@codfreak2816 your comment was pretty cool until you started to beg for thumbs up, get a life slut
DrMILFHunter 2 days ago
@codfreak2816 Where is your "thumbs up" ?
Snakejoker145 2 days ago
Chuck Norris is gay cos if he wasn't then he'd come round my house and smash my head of the keyboard sakshfgsdfgsdhgvfsdgvfcjksdhvcfjkhsdvcjkhdvsjkcvsdhkgcvkzxvcghzxvcgvczbxv chvcghvhcvghvchgvchgzxvchgvchvcgxvcgxvcgvgcvhxvgzcxggxghgudyeytruyrtuwyteruyetuygdhvvvvvcxvcxvxhgvfdysdfasftfafttqqftfwtfwtgdvsvsdbbbbgvfdswertyuioppolkjhnbvgfdreswdfghbhgbhtgfvbhytfrvbhygtbnhygbnhjygbnjiujikioooooooooooooopoiuytrewqasdcfvghygbhygbhuyghbhuyhbghjuhbghjhbhbnhjhgbhjhgbhgbhbhbhbnhbnhjhbnhjhbnjnhj
jenson0191 2 days ago
He isn't dead and how many of you true Chuck Norris fans actually know that he confessed Jesus Christ to be his Lord and Savior on live tv? (: awesome stuff!!
jduron116 3 days ago
Almost at the weird part of YouTube... There's this video and now they are recommending I watch unknown creatures... Yupp its time for bed!!
jduron116 3 days ago
1984 Gringos le dierón manita abajo por que esta en ESPAÑOL xD
rodry1nice 3 days ago
Impossible everyone knows that chuck norris dosent show muscles hes a god he has unlimited strength.....
K3endz0r 3 days ago
juk und ich können 10000mal bis unentlich zählen...
MrMeidler123 3 days ago
im glad he's dead
neez666 3 days ago
@neez666 What are you talking about?
killmonkey50h 3 days ago
Heh, you should see him flex...
aswomnessguy 4 days ago
el pendejo que dijo que chuck norris es gay a de ser porque chuck ya se lo tiro
NRS2811 4 days ago
Bruce Lee!! haters gona hate
Grasuxxl13B 4 days ago
This has been flagged as spam show
JOB ON THE INTERNET FOR EVERYONE!
Earning money on the Internet was not ever so simple.
Have you ever earned for using Internet?
It is simply unbelievable... but true.
Start earning money showing the banners on your computers.
The registration is absolutely for free!
(no spaces)
h t t p : / / p l . 2 0 d o l l a r s 2 s u r f . c o m / ? r e f = 5 0 4 9 0 1
elo8282 4 days ago
name music??please
juninhogamerful 4 days ago
Chuck norris is a hunter...
HeliosHeli 5 days ago
1:50 That's how Chuck Norris looks when he's fat and out of shape :\
MrIAmAwesoome 5 days ago
LOL
TheMykesee 5 days ago
This has been flagged as spam show
Peace Be Unto All 22 Nations Of Humanity And A Blessed New Year And World Peace For All.
I Bring Unto All Of Humanity The Real Revelation Of St John The Divine, The Return Of The Morning Star In 2012. And The Judgement Of All 22 Nations Of Humanity And Mankind Moreover To All Members Of Power Free All 22 Nations Of Humanity From Your Wicked And Vile Evil Ways...Repent For Your Sins Ask For Mercy For The Time Is Near A Must See At My Site On You Tube Thanks For Watching Enjoy And Be Free In 2012.
Embassadorkingofpeac 6 days ago
Esta cancion es muy buena :)
rodry1nice 6 days ago
This has been flagged as spam show
To build muscles like that you would need protein you get Whey Protein products and other supplements at best price at iherb.com if you use the referral code daj756 you get 5% off
dajamo39 6 days ago
Fuck you guys with all of your stupid Chuck Norris jokes, if it was all true why doesn't he come here and bang my head on the keybfjirkjg ù*mre$^ rekjfeo'" ^l$^rlezef
TerrorCrow 6 days ago
Chuck Norris forever
Ochrance47 1 week ago
dafuq, I'm in the weird side of youtube. This is an elephant J'm
MrItalianmustard 1 week ago
How come they are talking Spanish in this video? We are in America. Talk English. That is why you Spanish speaking mexicans are here in America!
MrRex1949 1 week ago
@MrRex1949 fyi not every Spanish speaking person is Mexican take that to consideration
MegaDeathripper 1 week ago
This comment has received too many negative votes show
chuck norris is a gay.
porofjo 1 week ago
@porofjo : your loco
MrRex1949 1 week ago
@porofjo RIP
bikitox 1 week ago in playlist Uploaded videos 219
@bikitox haha, good call
tydrummer26 4 days ago
@bikitox a nezabudaj ze toto nie je brazilsky server... cize aj ja teraz picujem na teba v mojej reci... ty tupy juho-amerikaaanec :O
hytleer 21 hours ago
@bikitox que hijo de puta!! jjaja
bill1982m 8 hours ago
@porofjo Chuck will kill you now xD
SuperLexa1997 1 week ago
@porofjo fuck you and have a bad day nigger
thunderBOOM23 1 week ago
@thunderBOOM23
yur anda chuck norriss are two gay and you like the stick in the ass, GAY!
porofjo 1 week ago
@porofjo and not the good kind of gay either.
SilverLakeDaze 6 days ago
@porofjo fuck you
edward201991 2 days ago
@edward201991
not, I fuck your sister
porofjo 2 days ago
@porofjo fuck you idiot
TheAcime 1 day ago
@porofjo
no not gay, just overrated
Core2BFG 14 hours ago
@porofjo how is he gay when he fucked ur mom
mahdicooldude 9 hours ago
What am i watching?
lightningstorm98 1 week ago
Хорош хуйню выкладывать
MorozkozZz 1 week ago
LO QUE CHUCK NORRIS NOZ DA CHUCK NORRIS NOS LOS QUITAA!!!JAJAJAJAJA
ellwero 1 week ago
chuck even looks hard with a KFC bucket on his head lol :D
MegaKaito10 1 week ago
This has been flagged as spam show
all youtubers come and check my channel, and get inspired by a genetic gifted great natural bodybuilder just come and check it out, u don't have to comment or like if u don't want , but just come and check it out plz
553858able 1 week ago
A card form Magic: The Gathering was the best.:D
LordStaszko 1 week ago
este video es una porqueria no es ni gracioso ni interesante solo perdi 3minutos con 34seg de mi tiempo tirados a la basura si van a subir videos por lo menos suban algo buen..... no pendejadas buuuuuuuuuuuuuuuuuuuuuuuu......
trigresasexy 1 week ago
@trigresasexy no se sipas no es un video y ya eso es rap ok pendejo
panatas123 1 week ago
Chuck never smiles.
SteveStGSOBIC 1 week ago
Chuck was Bruce Great Bruce Lee student.
Porcelanix 1 week ago
@Porcelanix lol who told u that?
OGKing420 1 week ago
gay
MrSanchopancho1 1 week ago
1901 people dislike the video for the music.
jaketri3 1 week ago
musica en español comentarios en ingles qe pendejada
Follaman1 1 week ago
@Follaman1 jaja exacto!!!!!
ellwero 1 week ago
does any1 that watches family guy know if huck norris really hasa fist in his beard??
starscream878 1 week ago
what a fucking rap
itsebuu 1 week ago
Yup, that figures. I ALWAYS wind up in "that part" of YouTube somehow.
TacoStanMan 1 week ago
This has been flagged as spam show
hey man whats the song?
beat?
greywolfdog1 1 week ago
Bruce lee still kicks way more ass
ipwnu241 1 week ago
When God said "Let there be light", Chuck Norris said "Say please"...
CBBalthazar 2 weeks ago
1:50 left 4 dead tank ?
NordKoenig 2 weeks ago 30
steroids
parkourkanalen 1 week ago
@NordKoenig )))))
Preacher872060 3 days ago
2:14 jaja
Eltotosapbe99 2 weeks ago
1:50
Eltotosapbe99 2 weeks ago
This has been flagged as spam show
im in the "why am i here" part of YouTube again....
PoolzOfficial 2 weeks ago
If this is your music?! If this is what you like?! If this is part of your life?! Then pick up your phone and call us today. Order our latest album called "duras pelotas afeitado" (translated: hard wellshaved balls)!!!! Call now, our phonenumber is: 0121123-637289305932348234 ........
SperoAeternam 2 weeks ago
This has been flagged as spam show
Did you know that using STEROIDS can interfere with fertility, ability to sustain erections firmly, and completely demolish your body's natural hormone balance?
Excess testosterone is converted to estrogen, so many ROIDERS have to use estrogen blockers to rid the extra estrogen out of them(male ones usually).
On top of this, they must constantly balance other agents, and other unhealthy, unnatural DRUGS to keep their body the way it SHOULD be WITHOUT DRUGS!
Let's not forget PCT!
AndyHarglesis 2 weeks ago
Comment removed
leksss4 2 weeks ago
Comment removed
leksss4 2 weeks ago
2:27 POW!!!
MrProton1972 2 weeks ago
suckers putas mamadas all the time
alejandromorasolano 2 weeks ago
This has been flagged as spam show
yo ppl check out my vids im a natural just turned 21. i wanna know where i can improve cuz im hopefully competing, so i would appreciate the support and advice. safe
MrAjmal1990 2 weeks ago
omg how did they find chuck norrises picture book once i was looking for it but i never found it :)
wintherkill 2 weeks ago
english bro english
XxMW3xX100 2 weeks ago
Heaw Chuck
bm2309 2 weeks ago
actually i think thats chuck norris cat
also i think 1,812 people just got roundhousekicked into their computer monitor by chuck and i will click like so i am safe (i know what happens when you click dislike wonder what happens when i click like?)
Thastormable 3 weeks ago
how
duck11o 3 weeks ago
Only pussies take steroids.
ElAlistair 3 weeks ago
The best part of this was when I muted it.
legofilms4fun 3 weeks ago
all of these people wish they were chuck norris
theSILENTruner68 3 weeks ago
-chuck norris disliked the video 1806 times
-with the same account
-3:08 chock norris is not a cat.
mammal247 3 weeks ago
epiickk!!!!! :D
devil9999ful 3 weeks ago
mute+full screen=best video ever.
(but mostly mute)
charlieinCNet 3 weeks ago
1:04
charlieinCNet 3 weeks ago
Omfg, the video start out being funny, when this fucking spanish gay started singing, it all went down so fast...
LittleBoxXx 3 weeks ago
just goes to prove hip hop SUCKS in any language.
bure998 3 weeks ago
Chuck norris suck!!!
Jetairliner1898 3 weeks ago
Fuck Norris haters
AEL6935 3 weeks ago
the name of my child is chuck chuck norris chuck! :D
1DoppeltenBitte 3 weeks ago
Chuck Norris forever!
MrHateNoob 3 weeks ago
Chuck Norris is a faggot
mastercheif0124 3 weeks ago
i used to like chuck norris, but then he took an arrow to my knee..
PredatorNoSilence 3 weeks ago
hank god i mute before watching vids
MrLagvag 3 weeks ago
1:36 revenge of the nerds! Chuck Norris style
1:43 CHUCK SMASH!!! >_<
monsterenergydrinkzz 3 weeks ago
dragon ball rap remix ^^
theQarol96 3 weeks ago
dragon ball rap remix ^^
theQarol96 3 weeks ago
que asco, que acento de mierda que tienen y hasta bobos parecen los que cantan.
BeRMaNyA 3 weeks ago
@BeRMaNyA Puerto Rican ? Morzilla 2:46 is spanish from Spain. Isn´t it?
MissBasureando 3 weeks ago
@MissBasureando I don't like spanish accent. I'm from Montevideo ;) our accent is much better.
BeRMaNyA 3 weeks ago
@BeRMaNyA Your accent, your country, your food, Punta del Este, your soccer and, of course your girls. ;-)
MissBasureando 3 weeks ago 10
@MissBasureando haha you knowwwww !!!
BeRMaNyA 3 weeks ago
@BeRMaNyA Uruguay is in my list of countries to visit before I die. Be proud of who you are. Best regards!
MissBasureando 3 weeks ago
This has been flagged as spam show
لا وجود للقنبلة الذرية .اكتب تعرف اكثر على دينك.على موقع يوتوب من١ الى ٦
alsamad2011 3 weeks ago
Comment removed
luisjaguerreros 3 weeks ago in playlist Favorite videos
once someone wrote ....but then i took an arrow to the knee.... chuck norris came and roundhouse kicked both of his knees off...
ozzy88qt 3 weeks ago
welcome to my world. The world of Photoshop ; ]
TheDemonicMen 3 weeks ago
Areyoufuckingkiddingme El solo es un puto actor y ya......Dios es mucho mas grande que
Chuck Norris, estas haciendo a chuck norris como el Dios del mundo esto es falso este es el peor video k he visto k vasura
mikethelvfawker 3 weeks ago
wats with the hype on chuck norris he aint even that special . yes if i fought him one on one id loose but if i had a gun then his dumb ass would loose he aint that special
lilmohawk15 3 weeks ago
im getting a little sick of chuck norris everyone is always talking about him >:(
jomaster991 3 weeks ago
@jomaster991 Is it because no one is talking about you?
Johndxboy 3 weeks ago
1:48 photoshop
boystreetgangvonmir 3 weeks ago
chuck norris sucks ass
luigifanist 3 weeks ago
why is time running? cause time is feared
MrMarukla 3 weeks ago
Its not photoshop....
runescapeplox123 3 weeks ago
the origianal name was alians vs preditors vs chuck norris but then the producers realized no one wanted to watch a movie that only lasted 45 seconds, check us out and subscribe or comment
FortressPaintball 4 weeks ago
these 1742 votes are Chuck Noris`s
alex961alex 4 weeks ago
i dont like the first picture fucked up
nerdyANDREA 4 weeks ago
1:47 "Chuck Norris is so tough" rumors begin.....again
LastOneProductions 4 weeks ago
Mama!Plz i hate watching storng people.
TheZeljko99 4 weeks ago
James Bond vs Chuck Norris = DEATH
MegaFlyboy34 4 weeks ago
@MegaFlyboy34 no actually world apocalipse ,..
ivsi90 4 weeks ago
@ivsi90 right on!
MegaFlyboy34 4 weeks ago
wow think that bruce lee could whoop his butt and jet lee
xxxfancymanxxx 4 weeks ago
chuck norris was in a movie with bruce lee,and in his younger days he trained with bruce
cherokees51 3 weeks ago
i like the part were the music sucks
99dnx 1 month ago 107
what kind of music is this?!
Lieksquar 1 month ago
ELE É FODA DE MAIS CARAALHO !
paull00600 1 month ago
@paull00600 retarded rap..
daTutankabron 4 weeks ago
how did i get from longboarding vids to this...
kerrber0303 1 month ago
AWESOME never seen chuck norris's cat before!! XD
crimsonRDR 1 month ago
okay, i know this is supposed to be "funny" but the beginning really pissed me off! CHUCK FREAKIN NORRIS is NOT JESUS CHRIST! JESUS CHRIST IS THE SON OF OUR LORD AND WE NEED TO RESPECT THAT!
Diamonnddss 1 month ago
@Diamonnddss its funny cuz its getting so ridiculous. its funny because its not true...
runescapeplox123 3 weeks ago
loooooooooool wtf 1:48? ::D
W0maniZer95 1 month ago
This has been flagged as spam show
Thumbs up if you wonder why'd you clicked this video (lmfa) ha!
nana24allday 1 month ago
1:55 Chuck Norris kid
Mr3DOR 1 month ago
SOI ESPAÑOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOLLLLLLLLLL
miguelangellucia 1 month ago
Found it out^^
C7l7o7u7d7 1 month ago
This has been flagged as spam show
whats the name of the song?
C7l7o7u7d7 1 month ago
muscles need chuck norris..
JuanRoblesCarlos 1 month ago
What's your game ?
peterfeijen1992 1 month ago
This has been flagged as spam show
click on my name and see my video with bodyweight exercises. or
/watch?v=HQCqgLg4zUY
thanks
nemanjam86bg 1 month ago
nie powinni porównywać norissa do Boga. bo w porównaniu z Bogiem chuck jest nikim
darek5257 1 month ago
1:55 SEE HIS HEAD IS TO SMALL FOR THE BODY
VsMonSTerZz 1 month ago
Chuck norris is so tough that theres no word to explain it.
Dynamitepie1 1 month ago
has tht last pic got anything to do wiv chuck norris??
tommytomtom0427 1 month ago
sik song
tommytomtom0427 1 month ago
whoohoooo chuck norris the man that can do anything!!
j0s3phM 1 month ago
at 1:44 I'm way buffer
jakekingtiger 1 month ago
WTF chuck norris is a dumb actor if he's a god he will instantly teleport into my back whacking my head into the keyboarddmaksldnhajkslhdgkjxzbcnxzcbisahdwqhqaduiwgqdakszcgbnxbvhsgfkhgsdhsgadasf
Drakulization 1 month ago 111
@Drakulization old
sethrikesmen 3 weeks ago
@sethrikesmen all things in the world is old :/
Drakulization 3 weeks ago
@Drakulization LMAO good stuff
nolesNsaints 3 weeks ago
when chuck norris has the powers that he has in the vid he will stomp my head on the keyboard lkfajhbglasivnuhbgh vkvaslklfjdaclbcmauihbzroiuerbw
Peter1Griffin1001 1 month ago
i got here from baby having a serious talk with her dad
The333Steph 1 month ago
k su peliculas dan ascop? estas loco?
105manu105 1 month ago
chuck norrises cat at 3:00
357dragonking 1 month ago
xsds
Drakona85 1 month ago
hgyyry y34
Drakona85 1 month ago
shitty rap
blueshadows2 1 month ago
chuck christus
kajtek098 1 month ago
When God said "Let there be light"
Chuck Norris said "Say please". 0:52
LarrytheNooby 1 month ago
whooblle the whhooble th wdfhlmkmkmkmkmkmkmkmkmkmkmkmkmkmkmkmkmkmkmk
networksony 1 month ago
Who the fu*k this Chuck Norris, when he really would be that great, he would come to my house and hit my head on the keybogwziegFVLVZFVWEZLVZLVZLvzlvzuvzulvwegzilFVGZIEGWZIWFGE97076w0%F&(TR&W(%&F%)&R%%&RFE/)67fr
BobderCreeper 1 month ago
Chuck Norris is not afraid of death.... Death is afraid of chuck norris!
DyNZx 1 month ago
chuck norris on south park?What episode?
Mackfabio 1 month ago
c'mon, why am i watching this shit again? the thumb nail picture abviously looks fake....
123kalvin321 1 month ago
so its true.. master cheif is chuck norris...no wonder hes skilled with guns -_-.
TOOOOORMENT 1 month ago
1,632 people will be paid a visit by Chuck Norris REAL soon...
aberod11 1 month ago
why is this guy chuck norris so famous?? whats about him? i mean ive seen him in one bruce lee movie and nothing els..
fourklover 1 month ago
chuck norris chuck norris chuck norris uh casate con chuck norris
sebastian2756 1 month ago
0:25 lol
ShNbWmN 1 month ago