I hope someone gets this reference, but the trampoline platforms in Ricco harbor, look like the Spongify carpets in the first three Harry Potter games for PC. If you get this, like or comment, I'd like to know.
Common misconception: Worms don't become two separate living things when cut in half. The half with the head can sometimes regenerate a tail, but they usually die. They die horrible, horrible deaths. Deadly deaths. Of death.
Actually this is done in galaxy 2. It is called twisty trials galaxy and it is only possible to do when you have defeated bowser once + you got 90 stars.
"WOW WOAH I GLITCHED ME WAY BACK ON!!! but no seriously guys the slope detection is a bit touchy" haha i love the fluctuation of emotion in that part:)
I think your really funny and cool but I have lots of trouble doing the racing and every time I lose that fat guy keeps telling me I should go to the kiddie pool that's so mest up
Do Skyward Sword chugaa!
lennyspizza 1 hour ago
This has been flagged as spam show
7:24 HA HA HA HA HA HA HA
TheDaniel12351 11 hours ago
Sloper!!!!!!!!!!!!! Its s-l-o-W-e-r
miarocks2020 1 day ago
Dude, I love how excited you get when you cheat death. Totally awesome.
AidaKittyBoy 1 day ago
9:24 Editing lives thumbs up so pepole can see!
jman12505 3 days ago
or at least netendo 64 game p,ay
greeny6924 3 days ago
I have a hard time now 2. Because of your videos I'm can be happy sometimes. THANK YOU. <33
xFemke2 5 days ago
Did his girlfriend breakup with him
jstuart16 1 week ago
ah who wacks someones tootsies like that???!! >.<
DebbyLovesMuffins 1 week ago in playlist More videos from chuggaaconroy
i love the caged shine sprite challedge. its just so cool!
ZeroSonic120 1 week ago 6
@ZeroSonic120 Nope. I disagree.
SuperSonicMachinima 1 week ago
@SuperSonicMachinima His opinion, not yourz. Or "yours", as Canadians from Canadia say it.
becky4paws 1 week ago
I know, but soon I kinda lost interest...
PhoenixDuelist 1 week ago
i played the pokemon trading card game video game and it was actually pretty fun for a while.
Mentro140 1 week ago
your nice to your friend
17friendc 2 weeks ago
This has been flagged as spam show
its friday
im eating grilled cheese
drinking hot chocolate
and watching chuggaaconroy
could this night get any better?
TheZeldalink09 2 weeks ago
Comment removed
TheZeldalink09 2 weeks ago
its new years
im eating fudgecicles
drinking..umm..
and watching this
how could my life get any better?!
wisecool8 2 weeks ago
@wisecool8 I know right. I used to HATE chuggaaconroy, but with this and pokemon firered, I love him! Not to mention ITS A PHANPY!
KiraismyLord 2 weeks ago
@wisecool8
It's the last day of the semester (high school)
I'm eating brownies
Drinking Powerade
and watching Chuggaaconroy.
How could my life get any better?
Digifreak9 1 week ago
Aww! Chugga ur so nice to give ur friend support on a LP!!!! even tho u said it over 3 years ago... its still sweet!!! XD
SuperBakaGirl 2 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN) 3
You sound like a good friend x
Tinker1999Bell 3 weeks ago
it can get better portalguy100 it can
anateratsu1 3 weeks ago
Kbbsi.e
TheMariposalovely 3 weeks ago
Does chuggaaconroy have a girl friend?
kandkcookies 3 weeks ago
has anyone else ever beat glooper blooper with no tentacles pulled off?
vegeetas 3 weeks ago in playlist More videos from chuggaaconroy
i have the water power jetpackk
yaayazeed 3 weeks ago
I hope someone gets this reference, but the trampoline platforms in Ricco harbor, look like the Spongify carpets in the first three Harry Potter games for PC. If you get this, like or comment, I'd like to know.
Jojoateyt 3 weeks ago
@Jojoateyt I always thought it'd be fun if you could use that particular spell on Mrs. Norris.
Me: Spongify!
Mrs. Norris: MREEOW!
PokemonSpectrum92 3 weeks ago
@PokemonSpectrum92 SOMEONE WHO UNDERSTANDS ME!!!!!
Jojoateyt 3 weeks ago
@Jojoateyt You're welcome.
PokemonSpectrum92 3 weeks ago
@Jojoateyt I got it! I had these three games.
luigiisthesecond 2 weeks ago
wrthwthwrthwergqwergwthwthwtrhwrthwrthwrthwrthwrthtrhwthwthwthwthwthwthwthwththwtrhwthwhhhwhwthwhwhthwthwthhwrthwhwhhthttthhttthtrrrgrgrgrgrrrgrgrgrgrtrhhteyytjyyyyttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyygfadfhghu90huhurhuewfowefhiowefwefhiowefhuqweruhu-grhu-grhu-hi-hi-hihi
HayzyKids 3 weeks ago
qergqerhqergqergqergqetrhqeriwrigwergqiergwrthqwrfgfasddqwqwgqrgqergqergqergqergqergqergqergfvergwfrwerfqweffqergqwerqwegqwerfqegrgqtrhtrhwscfaweqerhrykiulyiulyuilyuiymkikimuikuikyuiltyuituiltuilryjrgawqrfqewetrywtrwhrtwtthwthwththththththththththththththrhwrthwrthwrterthethetherthethrthrthehtrtherthwerthwrwerhwerhwthewrthwerthrthwrthwthwttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttwrthwrthwrtwww
HayzyKids 3 weeks ago
The last Shine in this video (the no-FLUDD) was copied into Super Mario Galaxy 2. Awesome...
TristanBomber 3 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
If u think bout it da music does sound like it
admiralbalthier 3 weeks ago
best mario game !!!!!!!!!!!!!!!!!!
TheSonic705 3 weeks ago
"all the shines in 50 videos".
nowadays that'd be easy. very easy. only vid 50 would probably a few hours long, knowing how slow I play to enjoy the game.
Felgrand101 3 weeks ago
Common misconception: Worms don't become two separate living things when cut in half. The half with the head can sometimes regenerate a tail, but they usually die. They die horrible, horrible deaths. Deadly deaths. Of death.
BattleScientist 3 weeks ago
do the hidden mansion in luigis mansion u do and ill suscribe
redamerican11 3 weeks ago
im in 2012 eating gummy bears drinking dr pepper ^^
sonicslittleangel01 4 weeks ago
i hope it gets better for your friend
Darkfoxdragon101 4 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
I wonder if everything did get better for Chugga's friend..
xXxFinalSephirothxXx 4 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
if you hover in the cave you can skip the race
darknavi21 4 weeks ago
lmao flip jump thing
piopark1 4 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
god i love chugga
creepercraft100 4 weeks ago in playlist More videos from chuggaaconroy
Thumbs up if you are watching this in 2024.
Im watching this on my vintage iHologram. (Made in 2013!)
I used my vintage time machine (Made in 2015!) to get to 2011. To be correct, 2012.
MasterOfParadox 1 month ago
@MasterOfParadox Yeah right. We all know ended in 2012. I mean you were there after all.
dracksan 4 weeks ago
0:06 no sound?
jonathan451406 1 month ago
0:01-0:04 like from Episode 5 you say
jonathan451406 1 month ago
i love that sonic song
TriSanReyes 1 month ago
Not twisty trails galaxy, no horror from the galaxy. (I'll be having nightmares about it again).
By the way: Did you know i hate twisty trails galaxy?
Darklegobrick13 1 month ago
Hey, did you know that 9:01 is Twisty Trials Galaxy?
smileykits 1 month ago
i got 36.29
4mjnt 1 month ago
chuggaaconroy is the coolest with playingwithmahwii
mindlessbehaviorocks 1 month ago
this was my first mario game! good times
skybluedude123 1 month ago
its Christmas Eve
im eating gummy bears
drinking Dr.Pepper
and watching Chuggaconroy
could this day get any better
portalguy100 1 month ago 72
@portalguy100 ya chuggaconroy came over to your house and gave you a free xbox and ps3
dackone2 1 month ago
Comment removed
MariosNewHat 1 month ago
@portalguy100 same thing (change gummy bears to candy canes)
MariosNewHat 1 month ago
@portalguy100 No, no it could not. That is an amazing day!
RamblingPanda 1 month ago
@portalguy100
Great taste in food. Not healthy, but great. Awesome how that works...
SSJkiller 3 weeks ago
@portalguy100 yeah. do you like sanity not included? or did you get skyrim for christmas?
legocontrollerjr 3 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
@legocontrollerjr
no unfortunately not but i'm about to buy it soon
portalguy100 3 weeks ago
@portalguy100 yes you could be smiling
200puppy7 3 weeks ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
@portalguy100 yes, suddenly, Santa Christ
BlitzkriegOmega 1 week ago
@portalguy100 Wish I could be where you were.
TheSpriternumbertwo 1 week ago
@TheSpriternumbertwo
Minnesota sucks
portalguy100 6 days ago
@portalguy100 ya
goku33331 6 days ago
@portalguy100 No, I meant still here in Michigan, but with the gummy bears and everything.
TheSpriternumbertwo 6 days ago
@TheSpriternumbertwo Michigan FTW!
supermario1998 5 days ago
@supermario1998 Oh yeah!
TheSpriternumbertwo 5 days ago
@TheSpriternumbertwo
oh hey Michigan isn't far off from MN
portalguy100 5 days ago
sory mistack 8yers.what does gramer mean?
sierrarschroeder 1 month ago
have you heard of pkgam
bullets132 1 month ago
Have you ever heard of minecraft?
canesfan123101 1 month ago
they might make super mario sunshine for the nintendo 3ds
andrewvswwe 1 month ago
thumbs down if your watching in 1102 yea take that 42% of youtube
Gamerboyz62 1 month ago
3:08 dammit! i was eating pasta at that moment!
ThePunkPhantom 1 month ago
"One does not simply walk into mordor"
Next time, on Chugga's lets play...
will3792 1 month ago
What detection is messed up? I didn't hear you.
THCKwarter 1 month ago
you could have cut through
SuperDwade16 1 month ago
You'd think for a Let's Player he'd do this legitly. LOL
azin231 1 month ago
anybody know chuggas first les play?
iggyman783 1 month ago
@iggyman783 Earthbound.
sk8terkid4life 1 month ago
@iggyman783 his first let's play was earthbound
KingofWindXCA 1 month ago
Thumbs up if you're watching this in 1398
Krysta911 1 month ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
@6000NoobTube Yes it does; both halves regrow and become 2 new worms.
MacandBloo4ever 1 month ago
this was one of the most hardest Mario game
lokdoggydog 1 month ago
Lol, yellow submarine! XD
LadyForeverAFan 1 month ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
A worm cut in half does not make 2. You get a dead worm.
6000NoobTube 1 month ago
@6000NoobTube The worm is still alive though.
ChrisLucewoALT 4 days ago
Thumbs up if you are Marty Mcfly and tou are watching this in 2015.
6000NoobTube 1 month ago 2
117 people failed at making a water jetpack.
TheGodPerson 1 month ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
after blooper surfing safari, who else decided to pretend to do a swimming race XD i did :)
sakuXsasu5545 1 month ago
@luke2042 so was mine :)
CCNerfProductions 1 month ago
@CCNerfProductions lol eww
mario194499 1 month ago
At 1:58 hes sucking a big penis!
mario194499 1 month ago
SUPER MARIO SUNSHI-
MoldyMooseTeeth 1 month ago
@MoldyMooseTeeth let me finish that for you. "SUPER MARIO SUNSHITS."
MegaError10 4 weeks ago
To think, this was my first chuggaa video. How far i've come...
Thaxxence 1 month ago
Actually this is done in galaxy 2. It is called twisty trials galaxy and it is only possible to do when you have defeated bowser once + you got 90 stars.
Darrenteo01 1 month ago
Did you here about munchingorange doing your "chugaconvoy thing" and saying that just to trick people. LOL x 9999
Markoblaster89 1 month ago
he says whatever too much
SButle1 1 month ago
"WOW WOAH I GLITCHED ME WAY BACK ON!!! but no seriously guys the slope detection is a bit touchy" haha i love the fluctuation of emotion in that part:)
SuperKitkatcrunch 1 month ago
@MEGASHADOW711 F U
TheShredder1234567 1 month ago
Thumbs up if you're watching this is 2019 because your a FRIKIN TIME TRAVELER
SpadesUmbreon 1 month ago 2
Me:MUHAHAHA! CHUGGAACONROY IS THE CONQUERER OF DEATH!
Bowser:He just got lucky.
Me:*Kills Bowser with frying pan and gives Bowser jr. a wedgie*
iceclaw364 1 month ago
i used the pink blooper
MEGASHADOW711 1 month ago
that time was easy to beat chuggaaconroy so in your face
MEGASHADOW711 1 month ago
@MEGASHADOW711 how do we know that you did it in less time then him?
immortalwintersage 1 month ago
@MEGASHADOW711 stop being a bitch to chugguconroy he is just trying to have fun
MegaError10 4 weeks ago
@MEGASHADOW711 also prove it
MegaError10 4 weeks ago
what is that purple thing.
robhod66 1 month ago
This has been flagged as spam show
Thumbs up if you want a pet blooper :D
frostblade808 2 months ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
your a dumvb
MegaCmpunkgts 2 months ago
your a d
MegaCmpunkgts 2 months ago
This has been flagged as spam show
please check out huskyMUPKINZ
ImaCreeper1256 2 months ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
realy, i owned a hampster befor he died on the california blackout.
MaskedManiac225 2 months ago
@MaskedManiac225 i never heardthe california black out wat is it?
MegaError10 4 weeks ago
This has been flagged as spam show
thumbs up if ur watching this in 2011
bizarrebuizel 2 months ago 178
@bizarrebuizel i am lol
3458andrew 2 months ago
@bizarrebuizel Thumb whore.Who cares what year people are watching a video?
youcouldbeme2020 1 month ago
@bizarrebuizel soon to be 2012!
JaWeegee9 1 month ago
@bizarrebuizel Nope, sorry. I'm watching this in 450 B.C. On my iStone.
scampynoXP 1 month ago in playlist More videos from chuggaaconroy 57
@scampynoXP
Ba dum chh
SSJkiller 3 weeks ago
@scampynoXP overused comment ftw
73zachman 1 day ago
@73zachman Must be overused now. I don't remember many people using it when I posted it.
scampynoXP 1 day ago
i loved you senc i was 6
sierrarschroeder 2 months ago
@sierrarschroeder Hello 7 year old with awful grammer
Spacecoreinspace 2 months ago
Lol
SadBlock191 2 months ago
I think your really funny and cool but I have lots of trouble doing the racing and every time I lose that fat guy keeps telling me I should go to the kiddie pool that's so mest up
megatyphlosion100 2 months ago
you using the emulator?
banjotooie11 2 months ago
symeko I am famst
bigtimehighroller300 2 months ago
fog you
bigtimehighroller300 2 months ago
09:00 hey! it's a stage from Mario Galaxy 2! i didnt know... cool
aquelescaraaaaaaaaaa 2 months ago
5 shine sprites in one day? I say this was a good day :)
DinoRoarrr 2 months ago
Comment removed
DinoRoarrr 2 months ago
Y U WATCH FOX NEWS!? O3O
333xan45 2 months ago
Chugga wanted to do 50 vids. He did 42.
TaylorSwift1958 2 months ago in playlist Let's Play #08: Super Mario Sunshine (GCN) 44
@TaylorSwift1958 ino i actuly think alot of people know
39cluesaddict1 2 months ago
@39cluesaddict1 i know but still...
TaylorSwift1958 2 months ago
Comment removed
sk8terkid4life 1 month ago
@TaylorSwift1958 He wanted to do less than 50.
sk8terkid4life 1 month ago
@TaylorSwift1958 41, one is the menu
averumsson 1 month ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
@TaylorSwift1958 spoilers
ChurroDoughnut 1 month ago
What was really funny Fred goes on a date with Judy is related O.O
sydney367 2 months ago
This has been flagged as spam show
@sydney367 As is Mario and luigi goes to Mcdonalds... ^_^
zonecastkids 2 months ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
Me:I destroyed the back tentacles
Chuggaa: really
Me:no
Chuggaa:SCREW YOU!
chuggaconvoy1 2 months ago
@r4rev does anyone care that you don't care, Mr. I Hate People who say things that I want to be a hater about.
ViridianEagle 2 months ago
Your lol is so omg I like it
stmaryslanding 2 months ago
I'am whaching this on my iPad
thasia55 2 months ago
alright
ihearthipsters 2 months ago
i have killed it without destroying one of it tenticals
MrYourface255 2 months ago in playlist Let's Play #08: Super Mario Sunshine (GCN)
Me too :O
LauraForeverable 2 months ago
I'm also watching on my ipod
limerslimer 2 months ago
MrCatty101 I am too!
MsSonic9 2 months ago
I love your let's play chuggaaconry
thasia55 2 months ago
Weird. I am too
thefaff999 2 months ago
I'm watching this on my iPod touch :)
MrCatty101 2 months ago
Chuggaaconroy Airways Let's Plays Inc.
Heplooner 2 months ago
Comment removed
Aidans125 2 months ago
I HAVE MARIO KART WII MY NAME IS DJ
satman169 2 months ago
I HAVE MARIO KART WII
satman169 2 months ago
Best lp ever
ben123767 2 months ago
1:57 I've seen enough hentia to know where this is going
AnvilPro100 2 months ago
Huh, I was actually never aware that the bloopers colors had different performance. Learn something new every day :P
PerfectKirby 2 months ago
Nevermind about that last comment.
AnthonyTheHedgehog1 2 months ago
Have you ever done the sequence break of actually pulling the cork/his "nose" even while the tentacles are still on?
AnthonyTheHedgehog1 2 months ago
Somehow this makes the wait for Skyrim tonight so much easier.
TheHelghastHunter 2 months ago
flipjumpthing?
MultiZdog123 2 months ago
stop talking!
MultiZdog123 2 months ago
06:51 YOU GRABBED ONTO THE LEDGE
ZoRanduWGiyz 2 months ago
OMG at 9:08 it's super mario galaxy 2 world S!!!!
tigerexslayer 2 months ago
he got OVER 9999 VIEWS
letsplayblooper 2 months ago
This has been flagged as spam show
i don't think so
jilly5999 2 months ago
If i were him,i'de run and hide!
pronovey 2 months ago
Dares a quicker way to do "The caged shinsprite"
jokamund 2 months ago
Oh my goodness! That last Shine Sprite Level was in Super Mario Galaxy 2!
myshagirl1 2 months ago
This has been flagged as spam show
@myshagirl1 how is it that this is a top comment if it doesn't even has thumbs up.
whackoskills78 2 months ago
I always hated blooper riding...
fleaboy498 3 months ago
@ThornHailsnap it's like ink that squids spray when they get scared
ScourgeIsAPsychoCat 3 months ago