@OccamsRzzr E-value is the "expectation value". Here's what the NCBI website has to say about it: "(It is) the number of different alignents with scores equivalent to or better than S that are expected to occur in a database search by chance." S is referring to the raw score. You can find out more about it at the NCBI website. Essentially, an e-value works like a p-value, the smaller the better.
Here's the rat sequence from this video, in case anyone wants to try it themselves:
>rat example protein
MGLWSPVPGNSVPRAPVMAGLGLGHSOGAPOBPHDGKTDRSSGPGRRRTERTRLPGLLGG
APLTAGSPHRWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMSHRMEGVGQLPA
SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCGGPSRLCKHVL
SARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKAGLGTWVRKPPE
QQQFLLTL
TheGiantSlor 2 weeks ago
grt ... for blast learner ,,,
tupac2133 7 months ago
I want to upload a set of sequences, what's the maximum sequences inside the file or the maximum size of the file to be uploaded?
rivosuoth 9 months ago
what is the evalue ? THis is soooo cool .
OccamsRzzr 1 year ago
@OccamsRzzr E-value is the "expectation value". Here's what the NCBI website has to say about it: "(It is) the number of different alignents with scores equivalent to or better than S that are expected to occur in a database search by chance." S is referring to the raw score. You can find out more about it at the NCBI website. Essentially, an e-value works like a p-value, the smaller the better.
rflejeune 1 year ago
@rflejeune Thanks. I downloaded the readme.
OccamsRzzr 1 year ago