I've got an even longer word, it's 189,822 letters. It's this 189,819-letter word followed by "ish", describing something that's kinda Titin-ish, but not really
I can spell the first 100 letters-methionylthreonylthreonylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleuc. I also know hippopotomonstrosesquippedaliophobia, floccinaucinihilipilification, honorificabilitudinitatibus,asseocarnisaguineoviscericartilaginonervomedullary,supercalifragilisticexpialidocious (just had to add that :P).......Brobdingnagian sesquipedalians and honorificabilitudinitatibus floccinaucinihilipilifications are a hobby of mine! XD
Fake? First go to the website in description, then scroll anywhere and take a small part of the word (around 10 letters), then copy the part. CTRL+F, search: Paste the part, press enter. Some parts of this "long" are common in the one big word. Is this fking word fake?!
what the hell does a scientist say to his mentor when he finds this chemical? Cuz they use the full names and all it would propably be like proffesor i found some daklnfsadlfnasdlnkfnjskfdhjshdjfjkaskdjfkahjslfhjasjhkdfakhjlslfhjalshjdfsxkckzxbcasdghfasidurtaduisfjkydfadsoiufhadjfhahdjkfvnsdjfjhiefudsfhsdjfjadsjfejsdkfhdjkfhakjdfjgesdfbfkahfdhfgayudgfhEhgdahjfdfdfhdgfhgaeghfsgdfgagfgaeagdfgyeuasdgfahsdfhjehasdfhadhjfahdjfheghsudfgdshgfegsadgfyagydsfgyagydygfygeygaYGdfgyaegdskjudfhkjhgirfghsdfds.
Everyone who commented on it saying "party" a bunch:
Aspartyl. It's a word. Apparently it's the "amino acid radical or residue of aspartic acid" according to Merriam Webster.
But I also agree that the full name isn't really a word... Just latin name after latin name for various compounds. This is why we nickname things in English and use practical words like "titin".
With all respect most of those words come from latin, it can not be considered the largest "english word". Besides english isn't an agglutinative language such as german or swedish, neither a polysynthetic language such as náhuatl . Thanks 189,819 letters ..
I don't understand how anyone could've invented this word... they must have been messing with the copy-paste feature when it was first introduced to computers.
party, lance, bluetooth and theeth. Lycel, respiration, asthma is tutu, sususususu, tree, trio, critical, battlesystem, Nathaniel, anabolism, Osparth, larging over the masculun, enlargen, protocol, milk, seduce, tender asthma pascal, Isosceles, vital system oh three, enlargen oh three. Vegetarian, enlargen, espeon mewtwo, Asparagus, sustainial, matilda, ninetynine, glutaniel (three times in a row actually), defeat, final panel over, long last three, lathre. glutu., SEX IS ALL I SEEN (last part)
blender as possible, blends them and chops up the words into legit sounding bits, throws them from the blender onto a wall of his house he covered with glue, does this a few times and walla,
When i listen to this i can make a theory on how this word was made, here it is:
Hey look what I discovered, I 'm not sure what to name it. 3 Days later of nonstop name thinking-up-ing later... I've got it. He writes down a few medical sounding words, shoves them into the copier, shoves as many copies into a
If you pauze the vid once in a while, you see that there are some spaces here and there, also I've seen the word "Threony" and "Poly" repeat itself multiple times, and probably other parts of words as well.
@SirNuX LOL. That is because the protein Titin consists of close to 27,000 amino acids linked together! There are about 20 common amino acids that are used to build proteins. One of those 20 acids, one is Threonine (of course the amino acids can be phosphorylated, acetylated, methylated ..., which changes their name slightly). Source; Lehninger Principles of Biochemistry, 5th Edition, Pages 70 -83. Biochemistry ROCKS!
@SirNuX It pauses because I made it using Windows Movie Maker, and you have to stitch separate scenes together, and they insist on putting tiny little pauses at the beginning.
That's great... BUT WILL IT BLEND?!
ADHDPod 20 hours ago
THIS IS WORSE THEN THE 10 HOURS NYAN CAT CHALLENGE!! *dies*
TsumeTheGreyWolf 1 day ago
This................ o.o
GeckoftheDerpz 1 day ago
*head explodes already at 0:40*
TsumeTheGreyWolf 1 day ago
Zrozumialem
fraytnxocbhgwsioemddssdpfewewedsfdsfdfsdmvmvsdkdsvmmvldvsmddsffdswgegbeewksd... -.- przez 8 minut
Darkoman777 1 day ago
I've got an even longer word, it's 189,822 letters. It's this 189,819-letter word followed by "ish", describing something that's kinda Titin-ish, but not really
atomicbolt 2 days ago
Methionylthreonylthreonylglutaminylarginylethionylphenolthreonylthreonylglutaminylarginylethionylthreonylthreonylglutaminylarginylethionylthreonylthreonhydroxyylglutaminylarginylisoleucine
AKA Titin
from212 2 days ago
LOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL
CyanideHappinesT 5 days ago
2:08 Just came.
backstabbingwhores 5 days ago
SO BRAVE
salutemeorsh00tme 6 days ago
@salutemeorsh00tme at least 6 ron pauls worth.....
toSTONEiGO 6 days ago
This has been flagged as spam show
I can spell the first 100 letters-methionylthreonylthreonylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleuc. I also know hippopotomonstrosesquippedaliophobia, floccinaucinihilipilification, honorificabilitudinitatibus,asseocarnisaguineoviscericartilaginonervomedullary,supercalifragilisticexpialidocious (just had to add that :P).......Brobdingnagian sesquipedalians and honorificabilitudinitatibus floccinaucinihilipilifications are a hobby of mine! XD
walkngdictonary 1 week ago
Why on earth did I just watch this whole thing?
ThePhiladelphiaPhan 1 week ago 3
my new ringtone
Rii3l 1 week ago 2
That's easy for you to say!
Ridwee 2 weeks ago
If this where font 72 and written in one line at earth, it will extend more than the distance of New York to Bali.
Rizkiheydrich16 2 weeks ago
It's not fake. That really is the chemical name (or at least part of it), the problem is that officially gene names are NOT words.
1IXxJOHNxXI1 3 weeks ago
It takes 8 minutes to say this?
ThePinkMamaLuigi 3 weeks ago
@ThePinkMamaLuigi 2 hours and 8 minutes, read the description
blarlego 3 weeks ago
I pulled this word off on scrabble once.
Pijege 3 weeks ago 3
The word party is in there 1362 times. Being a bit repetitive, are we?
jondalton007 3 weeks ago
this is just a bunch of repeated fucking words
TitanGuy22 4 weeks ago
@TitanGuy22 fuck you
7777777marine 3 weeks ago
fucking stupid and fake. Who would actually decide to make this word this god damn large?
TitanGuy22 4 weeks ago
@TitanGuy22 Do you know a fundamentals of chemistry?? This is not fake!
Soob1993 3 weeks ago
@Soob1993 Yes, I am a nuclear physicist............I know everything. It is fake.
TitanGuy22 2 weeks ago
@TitanGuy22 So you should back to school cuz you know nothing joining amino acids
Soob1993 2 weeks ago
@TitanGuy22
It wasn't decided by anyone, it's the chemical name for the largest protein.
CWINDOWSsystem32 2 weeks ago
Me: teacher what is the chemical name for titin?
Teacher: well it is methion.........
Me: -__-
dudeproductions100 4 weeks ago
Fake? First go to the website in description, then scroll anywhere and take a small part of the word (around 10 letters), then copy the part. CTRL+F, search: Paste the part, press enter. Some parts of this "long" are common in the one big word. Is this fking word fake?!
TheStoffl96 4 weeks ago
I paused the video on 1:35 and saw 3 times the wordt "PARTY" :)
ShoeFixers 1 month ago
Next Chemistry Exam(1 Question worth 100%)
Write the full chemical name for Titin
Quetzalma 1 month ago
Tht is alot of gibberish
runedude999 1 month ago
@TheMaiki4494: Pobre tu, aprendelo en ingles, sera mas "facil" jajajaja
Poor you, learn it in English, it will be "easier" :D
Bombsh0ck 1 month ago
alguien se lo sabe en español??? me la tengo que aprender para el miércoles!!!
someone translates it into Spanish???
I have to learn me for Wednesday!
TheMaiki4494 1 month ago
THE CHEMISTS ARE F*CKING WITH ME!!!
HoldTheseLimes 1 month ago
and that, my friends, is how you win a spelling bee
realwaluigi 1 month ago
like this if you took this video and slowed it down and listened to it
17cbig 1 month ago
...And a partridge in a pear tree!!!
TheACapMan 1 month ago 19
did i here rape my dog
alienshadowII 1 month ago 2
wow...
fullcel14 1 month ago
Who else at the end hears ''sex is all I see''??
xxiHeartHorsesxx 1 month ago
Then again, you could just call it Titin...
Musicman1720 1 month ago 43
WHY!? What is the purpose for this atrocity? SOMEONE EXPLAIN THIS BS TO ME!!
Lyiad 1 month ago 2
Omg I couldn't even finish this 8 min video. That word is ridiculous
Raine9 1 month ago
what the hell does a scientist say to his mentor when he finds this chemical? Cuz they use the full names and all it would propably be like proffesor i found some daklnfsadlfnasdlnkfnjskfdhjshdjfjkaskdjfkahjslfhjasjhkdfakhjlslfhjalshjdfsxkckzxbcasdghfasidurtaduisfjkydfadsoiufhadjfhahdjkfvnsdjfjhiefudsfhsdjfjadsjfejsdkfhdjkfhakjdfjgesdfbfkahfdhfgayudgfhEhgdahjfdfdfhdgfhgaeghfsgdfgagfgaeagdfgyeuasdgfahsdfhjehasdfhadhjfahdjfheghsudfgdshgfegsadgfyagydsfgyagydygfygeygaYGdfgyaegdskjudfhkjhgirfghsdfds.
TheCubeforce 1 month ago 3
Comment removed
Roshkin 1 month ago
SAY IT BACKWARDS
halfwaycrooked 1 month ago
Thanks now i can annoy people!!! :D
BlueMapler 1 month ago
Comment removed
BlueMapler 1 month ago
Mantra....OF SCIENCE!
Kiarnis 1 month ago
holy shit, was that long ass fuckin name really NECESSARY?!
iDIGRESSalot 1 month ago
@iDIGRESSalot Yes
burrowingcatpig 1 month ago
@burrowingcatpig Ohhhhhh, OK. I get.... Wait. Nope, I still don't get it. :( lol
iDIGRESSalot 1 month ago
@iDIGRESSalot chemical names state whats in the chemical. and seeing that its the largest known protein, it will have a long name!
burrowingcatpig 1 month ago
its funny every two minutes after i tune back in, i laugh to hear that its still going xD
TheEyesofGAGA 2 months ago
say it 3 times fast
xmonke55 2 months ago
Umm, you spelt character 120,164 wrong
sadnessinmylife 2 months ago
I'm sorry, i didnt catch that.
8675309BMAN 2 months ago
sorry, I don't speak chinese
8675309BMAN 2 months ago
I read the first thousand letters and I got sleepy
123freakinable 2 months ago
Simle way to call saitin!
vwerlingyahoocom 2 months ago
imagine how much protein this shit gives you
sweetcommand0 2 months ago 5
this was easy to masturbate to.
jamielennox12345 2 months ago
Simple way to call satan!
BABYSUN1 2 months ago 3
The advantage of taking speed?
Jasonater1 2 months ago
That's my YouTube password.
teo2609 2 months ago 4
Chemistry: Children, for tomorrow you have to memorize some names ...
blackevilization 2 months ago 2
O.o O M G
TDSProductions1 2 months ago
who else watched alll 8 minutes'???
TheDeeMonic 2 months ago 2
my password
caminuyu 2 months ago
@caminuyu OMG THEY ARE STEALING YUR PASSWORD!!!! IN GOT TA REPORT THIS!!!!
vwerlingyahoocom 2 months ago
Chuck Norris's Father's name
deraidos45 2 months ago 4
What the fucking shit?!
ultimatenoir 2 months ago
OH ... MY ... GOD
Dimos1997 2 months ago
Sounds Like Ludacris Rapping...
Jakeola1 2 months ago
Comment removed
xx9999999 2 months ago
Comment removed
xx9999999 2 months ago
If I ever told someone this and they were like.. what I wasnt listoning, I would kill them... xD
blodbeast 2 months ago
THAT IS SO WEIRD!!!!
redflame5000 2 months ago
Thumbs up if you watched the whole video
dlohoh978 2 months ago
Everyone who commented on it saying "party" a bunch:
Aspartyl. It's a word. Apparently it's the "amino acid radical or residue of aspartic acid" according to Merriam Webster.
But I also agree that the full name isn't really a word... Just latin name after latin name for various compounds. This is why we nickname things in English and use practical words like "titin".
JakeForrester79 2 months ago
I quit at 5:45. IT'S JUST TOO MUCH!
NKZilla 2 months ago
Oh god. I love you for making this!
Squishytheoctopus 3 months ago
I searched the full name in Google and it took me to an error page LOL
chuyitooooo 3 months ago
And thus, they summoned Cthulhu....
Barricade 3 months ago 5
this is my password for porn
MOOSENUT42 3 months ago 19
chuck norris says this everyday
MOOSENUT42 3 months ago
*mind blows*
sparkey6444 3 months ago
i only counted 183,876 words
pacmaneatsblueghosts 3 months ago
@pacmaneatsblueghosts That's a good effort considering there is only 189,819 letters...
lockednliftedgq 3 months ago
it sound like it said "SexiSolicine" at the end...
Fuzzolution88 3 months ago
@SirNuX Well guess what, words do that. Especially chemical names.
BrightMoon121 3 months ago
This has been flagged as spam show
Thumbs up if you love to say "glutaminy".
0YTMan 3 months ago
ENGLISH MuthaFucka do you speak it...
joske858 3 months ago
Try saying that 10 times fast
TheEmparor 3 months ago 55
@TheEmparor Chuck Norris said this over 9000 times in 10 seconds flat.
Chinese0Chicken 2 months ago
@TheEmparor TRY SAYING IT ONCE :P
anassalah96 2 months ago
fake this are 189,819
looserkidful 3 months ago
justin bieber's facebook password
aniza116 3 months ago in playlist Favoritos de aniza116 37
@aniza116 Oh yeah, totally! =D HAHAHA!
ChrisTheDragonRider 3 months ago
@ChrisTheDragonRider XD
aniza116 3 months ago
@aniza116
How is that funny at all you fucking dip shit?
BombDonald 2 months ago
@BombDonald whats wrong
aniza116 2 months ago
With all respect most of those words come from latin, it can not be considered the largest "english word". Besides english isn't an agglutinative language such as german or swedish, neither a polysynthetic language such as náhuatl . Thanks 189,819 letters ..
14Quovadis 3 months ago 3
can you translate ?
aniza116 3 months ago
Comment removed
PHAPPSWE 3 months ago
I heard the word mashed potatoes in the very beginning!! :)
TheHeyyapeople 3 months ago
I don't understand how anyone could've invented this word... they must have been messing with the copy-paste feature when it was first introduced to computers.
Zappy414 3 months ago
This is just insane, it's not even a word.
Lenders63 3 months ago
Sex is all i seen lol
ArgPollotuc 3 months ago
I paused at 1:00 and found the word party :D
lolzfiction 3 months ago
@lolzfiction I stopped at 1:35 for a pee brake and found party two times :)
PHAPPSWE 3 months ago
@PHAPPSWE I found it three times.
MrXienRa 3 months ago
@PHAPPSWE no party three times YEAHHHHH
aniza116 3 months ago in playlist Favoritos de aniza116
i tried writing this word... and i still am
SuperMonsterFTW 3 months ago
Just remember what I said in slow motion
MrVijfhoek 3 months ago
@MrVijfhoek Lol Portal 2
AustHut 3 months ago
And that my friends, is Chuck Norris' Computer Password.
AndroidXRecon 4 months ago 5
There are a mess of 'y's in this word...
WHY?!
SophyBerbzorz 4 months ago
I would roflmaoalol if i saw a teacher putting this whole word in a spelling test and put it in a sentence
mins332 4 months ago
This is Chuck Norris password
RDWGstudios 4 months ago
Thumbs up if you took a breath when the computer was saying it
ScarinPeopleIsFun 4 months ago
And yet it STILL doesn't use all the letters of the English alphabet!
It doesn't have B, F, J, K, Q, W, or Z.
Zguy09 4 months ago
Scientist 1: *reads the name out loud* yeah... how about we shorten the fuck out of this call it Titin
Scientist 2: Lol, you said tit.
ggcpres 4 months ago 4
Great. Now, say it backwards.
StainedShuriken333 4 months ago
Chuck Norris can say this in under 1 second.
chrisrodism 4 months ago 6
You made a spelling mistake...
LetsKillHitler 4 months ago
I pity the poor bastard who had to write this out, or even say it for the first time.
BlackWolfOfHell 4 months ago
Memorize that chemistry nerd!
(which i am :()
gamercode100 4 months ago
SOMEONE LOOP THIS XDXDXDXDXD
jackelfang21 5 months ago
party, lance, bluetooth and theeth. Lycel, respiration, asthma is tutu, sususususu, tree, trio, critical, battlesystem, Nathaniel, anabolism, Osparth, larging over the masculun, enlargen, protocol, milk, seduce, tender asthma pascal, Isosceles, vital system oh three, enlargen oh three. Vegetarian, enlargen, espeon mewtwo, Asparagus, sustainial, matilda, ninetynine, glutaniel (three times in a row actually), defeat, final panel over, long last three, lathre. glutu., SEX IS ALL I SEEN (last part)
AshiharaNakatsu12 5 months ago
@biggartenhaus I couldn't using the software that I used, although it is possible.
Sarah920 5 months ago
@biggartenhaus I couldn't using the software that I used, although it is possible.
Sarah920 5 months ago
THATS NOT EVEN A DAMN WORD!!!!
student71901 5 months ago
At 4.10 it says party 3 times :)
PaladinOfLondon 5 months ago 2
jajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajjaajajajajjaajj
chakachakabum 5 months ago
Read the lowest post by me first and it sounds better.
Zyvo2 5 months ago
blender as possible, blends them and chops up the words into legit sounding bits, throws them from the blender onto a wall of his house he covered with glue, does this a few times and walla,
comes out with this
Zyvo2 5 months ago
This is funny, I randomly stopped it at 3:45 and it says Party.
And at 3:48 too.
Probably a few more times in there too.
When i listen to this i can make a theory on how this word was made, here it is:
Hey look what I discovered, I 'm not sure what to name it. 3 Days later of nonstop name thinking-up-ing later... I've got it. He writes down a few medical sounding words, shoves them into the copier, shoves as many copies into a
Zyvo2 5 months ago
Comment removed
Zyvo2 5 months ago
Comment removed
Zyvo2 5 months ago
Why bother saying Titin? Let's just use this in everyday conversation
gmsquared 5 months ago 4
Yakko Warner would lose his shit.
TheLastHylianTitan 5 months ago 26
@TheLastHylianTitan Nice one. :)
Sarah920 5 months ago 3
lol l bet it says fuck you bitch retarded bastard son of a bitch
Destroyer629 5 months ago
Guy 1: "Hey, can I borrow your laptop for a minute?"
Guy 2: "Sure. Just let me type the password in."
Guy 1: "Ok."
Guy 2: *typing this word*
Best. Password. Ever.
rhandom1 5 months ago 6
@rhandom1 but easily accessible from the internet. its just typing it in...
armorhide406 5 months ago
My inner geek has today been truly satisfied...
MahonCarmody 5 months ago
"Can you use it in a sentence?"
Trylikeme23 5 months ago 4
me canse de escuchar el video
anonimo468 5 months ago
I have a new msn password :)
386kevint 5 months ago
So much...subliminal messages O_O
386kevint 5 months ago
The only only thing that catched is the last word which is :serxisoleucine
sonyviva308 5 months ago
@sonyviva308 That is a quite funny part. :)
Sarah920 5 months ago
Comment removed
generalj02 4 months ago
This has been flagged as spam show
@Sarah920 hay Sarah, do u think u'd be able to do a vid of the whole word please?
generalj02 4 months ago
Comment removed
sonyviva308 5 months ago
I feel pity for the people how has that long word phobia...
MercenaryX1 5 months ago
I ferociously fistpumped to this.
Yes, my brain DID explode along the way, but the pure epicness of this pushed me onwards.
SvDKILLSWITCH 5 months ago
That gave me a brain hemorrhage.
XxTheProphetArcxX 5 months ago
god mode achieved
iamthehighlander1 6 months ago
lmao
iamthehighlander1 6 months ago
@kevino0w
yes this is true
BigHornCanyon 6 months ago
If you pauze the vid once in a while, you see that there are some spaces here and there, also I've seen the word "Threony" and "Poly" repeat itself multiple times, and probably other parts of words as well.
I just say this is some bullcrap
SirNuX 6 months ago
@SirNuX google/wikipedia titin
7h3d4rkw0lf 6 months ago
@SirNuX I am not even going to dignify that with a response.
seahawksfan809 6 months ago
@SirNuX LOL. That is because the protein Titin consists of close to 27,000 amino acids linked together! There are about 20 common amino acids that are used to build proteins. One of those 20 acids, one is Threonine (of course the amino acids can be phosphorylated, acetylated, methylated ..., which changes their name slightly). Source; Lehninger Principles of Biochemistry, 5th Edition, Pages 70 -83. Biochemistry ROCKS!
scienceguy88 5 months ago
@SirNuX It pauses because I made it using Windows Movie Maker, and you have to stitch separate scenes together, and they insist on putting tiny little pauses at the beginning.
Sarah920 5 months ago
@SirNuX you do realise that would be because this is ALL the fucking chemicals in Titin, which is a pretty complex protein.
TheTrilbyWill 4 months ago
=_=
NorrisArt 6 months ago
O_O
NorrisArt 6 months ago
you missed a letter
GamerMet 6 months ago
@GamerMet LOL!!
marinuskyesteban 6 months ago
0:32... there's a break... two words?! :O